![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EcS508047.10 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
| Family | B3 | ||||||||
| Protein Properties | Length: 113aa MW: 12805.7 Da PI: 12.0438 | ||||||||
| Description | B3 family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | B3 | 64.3 | 1.9e-20 | 8 | 76 | 31 | 99 |
.--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
B3 31 eesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99
++++ l + d g++W++++ y+++s +yvlt+GW +Fvk++ L++gD++ F+++ e++l++ r+
EcS508047.10 8 PKGTLLNFIDGGGKVWRFRYLYWNSSHSYVLTRGWTRFVKEKSLRAGDIISFHRSAGPEKQLHINYMRR 76
5678899**********************************************9877888888887776 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50863 | 12.915 | 1 | 77 | IPR003340 | B3 DNA binding domain |
| SMART | SM01019 | 0.0051 | 2 | 77 | IPR003340 | B3 DNA binding domain |
| Gene3D | G3DSA:2.40.330.10 | 1.7E-21 | 7 | 76 | IPR015300 | DNA-binding pseudobarrel domain |
| SuperFamily | SSF101936 | 8.37E-19 | 8 | 76 | IPR015300 | DNA-binding pseudobarrel domain |
| Pfam | PF02362 | 8.4E-17 | 8 | 76 | IPR003340 | B3 DNA binding domain |
| CDD | cd10017 | 1.75E-14 | 17 | 62 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 113 aa Download sequence Send to blast |
NRSSPTTPKG TLLNFIDGGG KVWRFRYLYW NSSHSYVLTR GWTRFVKEKS LRAGDIISFH 60 RSAGPEKQLH INYMRRSGLS QARPVHPVQK VRLFGVNIFQ VSGTGRGVNC GGR |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wid_A | 2e-30 | 3 | 78 | 44 | 119 | DNA-binding protein RAV1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probably acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways (By similarity). Transcriptional repressor of flowering time on long day plants. Acts directly on FT expression by binding 5'-CAACA-3' and 5'-CACCTG-3 sequences (Probable). Functionally redundant with TEM1. {ECO:0000250, ECO:0000269|PubMed:18718758, ECO:0000305}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010040940.1 | 2e-63 | PREDICTED: AP2/ERF and B3 domain-containing transcription repressor TEM1 | ||||
| Swissprot | P82280 | 2e-35 | RAV2_ARATH; AP2/ERF and B3 domain-containing transcription repressor RAV2 | ||||
| TrEMBL | A0A059CBR5 | 9e-64 | A0A059CBR5_EUCGR; Uncharacterized protein | ||||
| STRING | XP_010040940.1 | 9e-63 | (Eucalyptus grandis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM848 | 27 | 121 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G68840.2 | 8e-38 | related to ABI3/VP1 2 | ||||




