PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EcS533381.10

Organism

Eucalyptus camaldulensis

Taxonomic ID

34316

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus

Family

M-type_MADS

Protein Properties

Length: 79aa MW: 9412.03 Da PI: 10.6588

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EcS533381.10	genome	ECGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	89.3	2e-28	10	59	2	51
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 +ien++nrqvt+skRrngi+KKA+EL vLCda+v+++++s + kl+ey+s EcS533381.10 10 KIENDTNRQVTYSKRRNGIFKKAHELTVLCDARVSILMLSGNKKLHEYIS 59 7***********************************************86 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	30.586	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	8.3E-37	1	60	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.23E-32	2	62	No hit	No description
SuperFamily	SSF55455	1.96E-29	2	62	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.5E-26	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	4.4E-24	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.5E-26	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.5E-26	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 79 aa Download sequence Send to blast
MGRGKIEIQK IENDTNRQVT YSKRRNGIFK KAHELTVLCD ARVSILMLSG NKKLHEYISP 60 TTTLYFKCQD LRRKYFLFR

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6byy_A	1e-14	1	59	1	59	MEF2 CHIMERA
6byy_B	1e-14	1	59	1	59	MEF2 CHIMERA
6byy_C	1e-14	1	59	1	59	MEF2 CHIMERA
6byy_D	1e-14	1	59	1	59	MEF2 CHIMERA
6bz1_A	9e-15	1	59	1	59	MEF2 CHIMERA
6bz1_B	9e-15	1	59	1	59	MEF2 CHIMERA
6bz1_C	9e-15	1	59	1	59	MEF2 CHIMERA
6bz1_D	9e-15	1	59	1	59	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the genetic control of flower development. Is required for normal development of petals and stamens in the wild-type flower. Forms a heterodimer with PISTILLATA that is required for autoregulation of both AP3 and PI genes. AP3/PI heterodimer interacts with APETALA1 or SEPALLATA3 to form a ternary complex that could be responsible for the regulation of the genes involved in the flower development. AP3/PI heterodimer activates the expression of NAP. AP3/PI prevents GATA22/GNL and GATA21/GNC expression (PubMed:18417639). {ECO:0000269\|PubMed:18417639, ECO:0000269\|PubMed:8565821, ECO:0000269\|PubMed:9489703}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Positively regulated by the meristem identity proteins APETALA1 and LEAFY with the cooperation of UFO. Repressed by silencing mediated by polycomb group (PcG) protein complex containing EMF1 and EMF2. {ECO:0000269\|PubMed:11283333, ECO:0000269\|PubMed:19783648}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010029721.1	1e-38	PREDICTED: floral homeotic protein DEFICIENS
Swissprot	P35632	4e-31	AP3_ARATH; Floral homeotic protein APETALA 3
TrEMBL	A0A059ARS4	2e-37	A0A059ARS4_EUCGR; Uncharacterized protein
TrEMBL	A0A059ASK8	2e-37	A0A059ASK8_EUCGR; Uncharacterized protein
STRING	XP_010029721.1	4e-38	(Eucalyptus grandis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM78	28	413

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G54340.1	2e-33	MIKC_MADS family protein

Publications ? help Back to Top
Furner I,Ellis L,Bakht S,Mirza B,Sheikh M CAUT lines: a novel resource for studies of cell autonomy in Arabidopsis. Plant J., 2008. 53(4): p. 645-60 [PMID:18269574] Jing D, et al. Two ancestral APETALA3 homologs from the basal angiosperm Magnolia wufengensis (Magnoliaceae) can affect flower development of Arabidopsis. Gene, 2014. 537(1): p. 100-7 [PMID:24334124] Zhang Y, et al. A cucumber DELLA homolog CsGAIP may inhibit staminate development through transcriptional repression of B class floral homeotic genes. PLoS ONE, 2014. 9(3): p. e91804 [PMID:24632777] Nakamura Y,Liu YC,Lin YC Floral glycerolipid profiles in homeotic mutants of Arabidopsis thaliana. Biochem. Biophys. Res. Commun., 2014. 450(4): p. 1272-5 [PMID:24984150] Behrend A,Borchert T,Hohe A "The usual suspects"- analysis of transcriptome sequences reveals deviating B gene activity in C. vulgaris bud bloomers. BMC Plant Biol., 2015. 15: p. 8 [PMID:25604890] Chen Z, et al. Overexpression of AtAP1M3 regulates flowering time and floral development in Arabidopsis and effects key flowering-related genes in poplar. Transgenic Res., 2015. 24(4): p. 705-15 [PMID:25820621] Yunus IS, et al. Phosphatidic acid is a major phospholipid class in reproductive organs of Arabidopsis thaliana. Plant Signal Behav, 2015. 10(8): p. e1049790 [PMID:26179579] Sun JJ, et al. CsAP3: A Cucumber Homolog to Arabidopsis APETALA3 with Novel Characteristics. Front Plant Sci, 2016. 7: p. 1181 [PMID:27540391]