![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EcS540542.10 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 55aa MW: 6257.26 Da PI: 9.6905 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 90.4 | 9.2e-29 | 2 | 45 | 8 | 51 |
HHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 8 nrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
rqvtfskRr+g+lKKA+ELSvLCdaevaviifs++g+lye+ss
EcS540542.10 2 SRQVTFSKRRTGLLKKAYELSVLCDAEVAVIIFSQKGRLYEFSS 45
69****************************************96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF55455 | 9.03E-24 | 1 | 49 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 25.539 | 1 | 47 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 1.7E-23 | 1 | 46 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 2.2E-25 | 1 | 43 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.1E-18 | 9 | 24 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.1E-18 | 24 | 45 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 55 aa Download sequence Send to blast |
TSRQVTFSKR RTGLLKKAYE LSVLCDAEVA VIIFSQKGRL YEFSSTSEYV QVPIL |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1tqe_P | 2e-16 | 2 | 47 | 16 | 61 | Myocyte-specific enhancer factor 2B |
| 1tqe_Q | 2e-16 | 2 | 47 | 16 | 61 | Myocyte-specific enhancer factor 2B |
| 1tqe_R | 2e-16 | 2 | 47 | 16 | 61 | Myocyte-specific enhancer factor 2B |
| 1tqe_S | 2e-16 | 2 | 47 | 16 | 61 | Myocyte-specific enhancer factor 2B |
| 6c9l_A | 2e-16 | 2 | 47 | 16 | 61 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 2e-16 | 2 | 47 | 16 | 61 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 2e-16 | 2 | 47 | 16 | 61 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 2e-16 | 2 | 47 | 16 | 61 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 2e-16 | 2 | 47 | 16 | 61 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 2e-16 | 2 | 47 | 16 | 61 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | MADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010035068.1 | 1e-25 | PREDICTED: MADS-box protein AGL42 | ||||
| Refseq | XP_010041409.2 | 8e-26 | PREDICTED: MADS-box protein AGL42-like | ||||
| Swissprot | Q9FIS1 | 4e-22 | AGL42_ARATH; MADS-box protein AGL42 | ||||
| TrEMBL | A0A058ZX09 | 4e-27 | A0A058ZX09_EUCGR; Uncharacterized protein | ||||
| STRING | XP_010035068.1 | 4e-25 | (Eucalyptus grandis) | ||||
| STRING | XP_010041409.1 | 1e-25 | (Eucalyptus grandis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM78 | 28 | 413 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G62165.4 | 2e-24 | AGAMOUS-like 42 | ||||




