![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EcS564948.10 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 80aa MW: 9130.54 Da PI: 9.0166 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 59.3 | 8.4e-19 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WT+eEd +lv +++++G+g+W++++ g+ R+ k+c++rw +yl
EcS564948.10 14 KGPWTPEEDIILVSYIQEHGPGNWRSVPTNTGLLRCSKSCRLRWTNYL 61
79******************************99************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 24.194 | 9 | 65 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 5.3E-22 | 12 | 60 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 2.4E-14 | 13 | 63 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 1.9E-17 | 14 | 61 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 1.15E-20 | 15 | 79 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 1.41E-12 | 16 | 61 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 6.5E-5 | 61 | 79 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 80 aa Download sequence Send to blast |
MGRPPCCDQV GIKKGPWTPE EDIILVSYIQ EHGPGNWRSV PTNTGLLRCS KSCRLRWTNY 60 LRPGIKRGNF TPHEEGMIIH |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor involved in the regulation of gene (e.g. drought-regulated and flavonoid biosynthetic genes) expression and stomatal movements leading to negative regulation of responses to drought and responses to other physiological stimuli (e.g. light). {ECO:0000269|PubMed:22018045}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Repressed by abscisic acid (ABA) and osmotic stress (salt stress). {ECO:0000269|PubMed:22018045}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_022743457.1 | 7e-57 | myb-related protein 306-like | ||||
| Swissprot | B3VTV7 | 3e-55 | MYB60_VITVI; Transcription factor MYB60 | ||||
| TrEMBL | A0A061F7E0 | 2e-54 | A0A061F7E0_THECC; Myb domain protein 60 | ||||
| TrEMBL | A0A0B0MDL6 | 6e-55 | A0A0B0MDL6_GOSAR; Myb-related protein | ||||
| TrEMBL | A0A0D2VHT3 | 7e-55 | A0A0D2VHT3_GOSRA; Uncharacterized protein | ||||
| TrEMBL | A0A2N9I3I4 | 9e-55 | A0A2N9I3I4_FAGSY; Uncharacterized protein | ||||
| TrEMBL | A0A2P5RCN4 | 8e-55 | A0A2P5RCN4_GOSBA; Uncharacterized protein | ||||
| STRING | XP_006484863.1 | 6e-56 | (Citrus sinensis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM4 | 28 | 2646 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G08810.1 | 2e-57 | myb domain protein 60 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




