PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EcS571258.10

Organism

Eucalyptus camaldulensis

Taxonomic ID

34316

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus

Family

GRF

Protein Properties

Length: 188aa MW: 20310.7 Da PI: 9.7975

Description

GRF family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EcS571258.10	genome	ECGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRC	74.3	1.3e-23	83	127	1	45
WRC 1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 d+epgrCrRtDGKkWRCs+++ +++k+CErH++rgr rsrk++e+ EcS571258.10 83 DPEPGRCRRTDGKKWRCSKDAHPDSKYCERHMNRGRYRSRKPVES 127 79****************************************986 PP
2	QLQ	55.7	1.5e-19	22	56	2	36
QLQ 2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36 +FT aQ+q+L++Q+l++KyL a++ vPpeLl++i EcS571258.10 22 PFTVAQWQELEHQALIFKYLKAGLSVPPELLAPIH 56 9********************************95 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00951	4.5E-11	21	57	IPR014978	Glutamine-Leucine-Glutamine, QLQ
Pfam	PF08880	9.4E-15	22	55	IPR014978	Glutamine-Leucine-Glutamine, QLQ
PROSITE profile	PS51666	22.308	22	57	IPR014978	Glutamine-Leucine-Glutamine, QLQ
PROSITE profile	PS51667	24.727	83	127	IPR014977	WRC domain
Pfam	PF08879	2.6E-20	84	126	IPR014977	WRC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0005524	Molecular Function	ATP binding

Sequence ? help Back to Top
Protein Sequence Length: 188 aa Download sequence Send to blast
SVGGGGGGGG GGGGGGGGGW PPFTVAQWQE LEHQALIFKY LKAGLSVPPE LLAPIHRSLE 60 SMSARLLHYP SFGYYSFYGK KIDPEPGRCR RTDGKKWRCS KDAHPDSKYC ERHMNRGRYR 120 SRKPVESQTV SQSLSTTTLD VATGSSSGGR SFQNLPSQSL SNPVNLCFGS GLSQLQVETS 180 PYGNYNKY

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that plays a role in the regulation of meristematic function in leaves, stems and inflorescences (PubMed:24532604). Transcription activator that plays a regulatory role in grain development (PubMed:26187814, PubMed:27250747, PubMed:27250749, PubMed:26936408, PubMed:27107174). Positively regulates grain size by promoting cell division and expansion, leading to increased grain length and width (PubMed:26187814, PubMed:27250747, PubMed:27250749, PubMed:26936408, PubMed:27107174). Positively regulates the expression of genes promoting cell proliferation (PubMed:26187814, PubMed:26936408). Activates the expression of expansin genes to promote cell expansion and grain size (PubMed:27250747). May promote grain size by activating brassinosteroid responses (PubMed:27250747). Component of a network formed by the microRNA396 (miRNA396), the GRFs and their interacting factors (GIFs) acting in the regulation of meristem function, at least partially through the control of cell proliferation (Probable). Component of the miRNA396c-GRF4-GIF1 regulatory module that plays an important role in grain size determination (Probable) (PubMed:27250747, PubMed:27250749, PubMed:27107174). {ECO:0000269\|PubMed:24532604, ECO:0000269\|PubMed:26187814, ECO:0000269\|PubMed:26936408, ECO:0000269\|PubMed:27107174, ECO:0000269\|PubMed:27250747, ECO:0000269\|PubMed:27250749, ECO:0000305\|PubMed:26187814, ECO:0000305\|PubMed:27107174, ECO:0000305\|PubMed:27250747, ECO:0000305\|PubMed:27250749}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: The microRNA396c negatively regulates GRF4 at the transcriptional level. {ECO:0000269\|PubMed:26187814, ECO:0000269\|PubMed:26936408, ECO:0000269\|PubMed:27107174, ECO:0000269\|PubMed:27250747}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010054073.2	1e-134	PREDICTED: growth-regulating factor 4
Refseq	XP_018727995.1	1e-134	PREDICTED: growth-regulating factor 4
Swissprot	Q6ZIK5	3e-54	GRF4_ORYSJ; Growth-regulating factor 4
TrEMBL	A0A059CJS0	2e-87	A0A059CJS0_EUCGR; Uncharacterized protein
STRING	XP_010054073.1	4e-88	(Eucalyptus grandis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM14339	10	19

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G13960.1	9e-44	growth-regulating factor 5

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Kuijt SJ, et al. Interaction between the GROWTH-REGULATING FACTOR and KNOTTED1-LIKE HOMEOBOX families of transcription factors. Plant Physiol., 2014. 164(4): p. 1952-66 [PMID:24532604] Hu J, et al. A Rare Allele of GS2 Enhances Grain Size and Grain Yield in Rice. Mol Plant, 2015. 8(10): p. 1455-65 [PMID:26187814] Sun P, et al. OsGRF4 controls grain shape, panicle length and seed shattering in rice. J Integr Plant Biol, 2016. 58(10): p. 836-847 [PMID:26936408] Li S, et al. The OsmiR396c-OsGRF4-OsGIF1 regulatory module determines grain size and yield in rice. Plant Biotechnol. J., 2016. 14(11): p. 2134-2146 [PMID:27107174] Che R, et al. Control of grain size and rice yield by GL2-mediated brassinosteroid responses. Nat Plants, 2015. 2: p. 15195 [PMID:27250747] Duan P, et al. Regulation of OsGRF4 by OsmiR396 controls grain size and yield in rice. Nat Plants, 2015. 2: p. 15203 [PMID:27250749]