PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcS586720.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family M-type_MADS
Protein Properties Length: 53aa    MW: 6137.17 Da    PI: 10.1747
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcS586720.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF96.51.1e-30147551
                  SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
        SRF-TF  5 nksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                  nk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s
  EcS586720.10  1 NKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 47
                  89*******************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.9E-26148IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.57E-25149IPR002100Transcription factor, MADS-box
PfamPF003191.3E-25145IPR002100Transcription factor, MADS-box
PROSITE profilePS5006626.324149IPR002100Transcription factor, MADS-box
PRINTSPR004043.4E-201126IPR002100Transcription factor, MADS-box
PRINTSPR004043.4E-202647IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 53 aa     Download sequence    Send to blast
NKINRQVTFA KRRNGLLKKA YELSVLCDAE VALIIFSNRG KLYEFCSSPR FDL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_A3e-164491560Myocyte-specific enhancer factor 2A
3mu6_B3e-164491560Myocyte-specific enhancer factor 2A
3mu6_C3e-164491560Myocyte-specific enhancer factor 2A
3mu6_D3e-164491560Myocyte-specific enhancer factor 2A
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor active in inflorescence development and floral organogenesis. Functions with SEPALLATA1/AGL2 and SEPALLATA2/AGL4 to ensure proper development of petals, stamens and carpels and to prevent the indeterminate growth of the flower meristem. Interacts with APETALA1, AGAMOUS or APETALA3/PISTILLATA to form complexes, that could be involved in genes regulation during floral meristem development (PubMed:10821278, PubMed:11206550). Binds specifically to the CArG box DNA sequence 5'-CC (A/T)6 GG-3' (PubMed:16080001). {ECO:0000269|PubMed:10821278, ECO:0000269|PubMed:11206550, ECO:0000269|PubMed:16080001}.
UniProtProbable transcription factor that binds specifically to the CArG box DNA sequence 5'-CC (A/T)6 GG-3' (PubMed:7632923, PubMed:25183521). Plays an important role in the determination of flower meristem identity. Involved in the specification of sepal identity. Contributes to the development of petals, stamens and carpels (PubMed:15530395). {ECO:0000269|PubMed:15530395, ECO:0000269|PubMed:25183521, ECO:0000269|PubMed:7632923}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007153483.11e-29hypothetical protein PHAVU_003G039400g
SwissprotO224566e-27SEP3_ARATH; Developmental protein SEPALLATA 3
SwissprotP293836e-27AGL3_ARATH; Agamous-like MADS-box protein AGL3
TrEMBLA0A2H5MYT23e-28A0A2H5MYT2_CITUN; Uncharacterized protein
TrEMBLV7C5L02e-28V7C5L0_PHAVU; Uncharacterized protein
STRINGXP_007153483.14e-29(Phaseolus vulgaris)
STRINGLus100178706e-29(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03710.34e-31MIKC_MADS family protein
Publications ? help Back to Top
  1. Maejima K, et al.
    Recognition of floral homeotic MADS domain transcription factors by a phytoplasmal effector, phyllogen, induces phyllody.
    Plant J., 2014. 78(4): p. 541-54
    [PMID:24597566]
  2. MacLean AM, et al.
    Phytoplasma effector SAP54 hijacks plant reproduction by degrading MADS-box proteins and promotes insect colonization in a RAD23-dependent manner.
    PLoS Biol., 2014. 12(4): p. e1001835
    [PMID:24714165]
  3. Iglesias FM, et al.
    The arabidopsis DNA polymerase δ has a role in the deposition of transcriptionally active epigenetic marks, development and flowering.
    PLoS Genet., 2015. 11(2): p. e1004975
    [PMID:25693187]
  4. He Q,Fu AY,Zhang GC,Li TJ,Zhang JH
    Arabidopsis thaliana SEPALLATA3 protein prokaryotic expression and purification.
    Cell. Mol. Biol. (Noisy-le-grand), 2015. 61(2): p. 60-3
    [PMID:26025404]
  5. Maejima K, et al.
    Degradation of class E MADS-domain transcription factors in Arabidopsis by a phytoplasmal effector, phyllogen.
    Plant Signal Behav, 2015. 10(8): p. e1042635
    [PMID:26179462]
  6. Muiño JM, et al.
    Evolution of DNA-Binding Sites of a Floral Master Regulatory Transcription Factor.
    Mol. Biol. Evol., 2016. 33(1): p. 185-200
    [PMID:26429922]
  7. Shi Q,Zhou J,Wang P,Lin X,Xu Y
    Protein expression and characterization of SEP3 from Arabidopsis thaliana.
    Genet. Mol. Res., 2015. 14(4): p. 12529-36
    [PMID:26505403]
  8. He Q,Fu AY,Zhang GC,Li TJ,Zhang JH
    Cloning, Prokaryotic Expression and Purification of CpfS1 Gene from Arabidopsis Thaliana.
    Cell. Mol. Biol. (Noisy-le-grand), 2015. 61(8): p. 123-7
    [PMID:26718440]
  9. Soza VL,Snelson CD,Hewett Hazelton KD,Di Stilio VS
    Partial redundancy and functional specialization of E-class SEPALLATA genes in an early-diverging eudicot.
    Dev. Biol., 2016. 419(1): p. 143-155
    [PMID:27502434]
  10. Conn VM, et al.
    A circRNA from SEPALLATA3 regulates splicing of its cognate mRNA through R-loop formation.
    Nat Plants, 2017. 3: p. 17053
    [PMID:28418376]
  11. Käppel S,Melzer R,Rümpler F,Gafert C,Theißen G
    The floral homeotic protein SEPALLATA3 recognizes target DNA sequences by shape readout involving a conserved arginine residue in the MADS-domain.
    Plant J., 2018. 95(2): p. 341-357
    [PMID:29744943]