![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EcS588623.10 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
| Family | G2-like | ||||||||
| Protein Properties | Length: 101aa MW: 11222.5 Da PI: 7.0906 | ||||||||
| Description | G2-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | G2-like | 53.3 | 6e-17 | 1 | 30 | 27 | 56 |
G2-like 27 AtPktilelmkvkgLtlehvkSHLQkYRla 56
AtPk+i+elm+v+gLt+++vkSHLQkYRl+
EcS588623.10 1 ATPKQIRELMQVDGLTNDEVKSHLQKYRLH 30
9***************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF46689 | 1.36E-6 | 1 | 33 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 11.013 | 1 | 32 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 1.7E-14 | 1 | 33 | IPR009057 | Homeodomain-like |
| TIGRFAMs | TIGR01557 | 1.0E-13 | 1 | 30 | IPR006447 | Myb domain, plants |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 101 aa Download sequence Send to blast |
ATPKQIRELM QVDGLTNDEV KSHLQKYRLH NQRHPIKAFR SQKSGIQTVL EMATDISGDS 60 LKMTGPQSPS PQSSFHIAGN PGLTSHTASD SMEEDREPRD P |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional repressor that functions with ULT1 in a pathway which regulates floral meristem homeostasis and organ number in the flower. Binds specifically to the DNA sequence motif 5'-GTAGATTCCT-3' of WUS promoter, and may be involved in direct regulation of WUS expression. Binds specifically to the DNA sequence motif 5'-AAGAATCTTT-3' found in the promoters of AG and the NAC domain genes CUC1, CUC2 and CUC3, and may be involved in direct regulation of these gene expressions. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010028507.1 | 6e-66 | PREDICTED: myb family transcription factor EFM isoform X2 | ||||
| Swissprot | F4JRB0 | 5e-14 | HHO5_ARATH; Transcription factor HHO5 | ||||
| TrEMBL | A0A059ANG4 | 2e-65 | A0A059ANG4_EUCGR; Uncharacterized protein | ||||
| STRING | XP_010028507.1 | 2e-65 | (Eucalyptus grandis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM20696 | 3 | 6 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G37180.1 | 2e-16 | G2-like family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




