PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EcS596752.10

Organism

Eucalyptus camaldulensis

Taxonomic ID

34316

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus

Family

LBD

Protein Properties

Length: 50aa MW: 5627.67 Da PI: 10.3793

Description

LBD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EcS596752.10	genome	ECGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	DUF260	60.6	4.3e-19	13	50	1	38
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFG 38 +CaaCk+lrr+Ca+dCv+apyfpa+qp+kfa+vhk+FG EcS596752.10 13 PCAACKLLRRRCARDCVFAPYFPADQPQKFAIVHKVFG 50 7************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50891	16.521	12	50	IPR004883	Lateral organ boundaries, LOB
Pfam	PF03195	3.4E-17	13	50	IPR004883	Lateral organ boundaries, LOB

Sequence ? help Back to Top
Protein Sequence Length: 50 aa Download sequence Send to blast
MKESGRKQGT LSPCAACKLL RRRCARDCVF APYFPADQPQ KFAIVHKVFG

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5ly0_A	1e-15	9	50	7	48	LOB family transfactor Ramosa2.1
5ly0_B	1e-15	9	50	7	48	LOB family transfactor Ramosa2.1
Search in ModeBase

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010064042.1	5e-31	PREDICTED: LOB domain-containing protein 4 isoform X1
Swissprot	Q9SHE9	2e-25	LBD4_ARATH; LOB domain-containing protein 4
TrEMBL	A0A059C0A2	1e-29	A0A059C0A2_EUCGR; Uncharacterized protein
STRING	XP_010064042.1	2e-30	(Eucalyptus grandis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM131	28	340

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G31320.1	2e-14	LOB domain-containing protein 4