PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EcS647077.10

Organism

Eucalyptus camaldulensis

Taxonomic ID

34316

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus

Family

M-type_MADS

Protein Properties

Length: 91aa MW: 10511.3 Da PI: 9.6171

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EcS647077.10	genome	ECGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	99.9	9.8e-32	25	75	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtf+kRrng+lKKA+ELSvLC+aeva+i+fss+g+lyey++ EcS647077.10 25 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCEAEVALIVFSSRGRLYEYAN 75 79***********************************************85 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	9.9E-42	17	76	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	33.529	17	77	IPR002100	Transcription factor, MADS-box
CDD	cd00265	3.81E-40	18	79	No hit	No description
SuperFamily	SSF55455	6.93E-30	18	77	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.0E-33	19	39	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	19	73	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	8.5E-27	26	73	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.0E-33	39	54	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.0E-33	54	75	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 91 aa Download sequence Send to blast
MVFPTQATPE ESPQRKMGRG KIEIKRIENT TNRQVTFCKR RNGLLKKAYE LSVLCEAEVA 60 LIVFSSRGRL YEYANDRYLC SLLFGLFCLI S

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	5e-21	17	79	1	66	Myocyte-specific enhancer factor 2B
1tqe_Q	5e-21	17	79	1	66	Myocyte-specific enhancer factor 2B
1tqe_R	5e-21	17	79	1	66	Myocyte-specific enhancer factor 2B
1tqe_S	5e-21	17	79	1	66	Myocyte-specific enhancer factor 2B
6c9l_A	5e-21	17	79	1	66	Myocyte-specific enhancer factor 2B
6c9l_B	5e-21	17	79	1	66	Myocyte-specific enhancer factor 2B
6c9l_C	5e-21	17	79	1	66	Myocyte-specific enhancer factor 2B
6c9l_D	5e-21	17	79	1	66	Myocyte-specific enhancer factor 2B
6c9l_E	5e-21	17	79	1	66	Myocyte-specific enhancer factor 2B
6c9l_F	5e-21	17	79	1	66	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers. {ECO:0000250}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001289652.1	1e-49	glycogen debranching enzyme
Refseq	XP_010057184.1	1e-49	PREDICTED: glycogen debranching enzyme isoform X1
Refseq	XP_010057185.1	1e-49	PREDICTED: glycogen debranching enzyme isoform X2
Refseq	XP_010057186.1	1e-49	PREDICTED: glycogen debranching enzyme isoform X2
Refseq	XP_018728407.1	1e-49	PREDICTED: glycogen debranching enzyme isoform X1
Swissprot	Q43585	1e-40	AG_TOBAC; Floral homeotic protein AGAMOUS
TrEMBL	A0A059C6W4	3e-48	A0A059C6W4_EUCGR; Uncharacterized protein
TrEMBL	C0STT0	3e-48	C0STT0_EUCGR; Agamous-like protein
STRING	XP_010057183.1	5e-49	(Eucalyptus grandis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM78	28	413

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G18960.1	5e-39	MIKC_MADS family protein

Publications ? help Back to Top
Cheung AY,Zhan XY,Wang H,Wu HM Organ-specific and Agamous-regulated expression and glycosylation of a pollen tube growth-promoting protein. Proc. Natl. Acad. Sci. U.S.A., 1996. 93(9): p. 3853-8 [PMID:8632979]