![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EcS656811.10 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 55aa MW: 6244.92 Da PI: 5.6272 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 32.4 | 2.6e-10 | 2 | 51 | 45 | 94 |
DUF260 45 llkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94
+l+++p+++r da++ lvyeA+ar +dPv+G g + ++ + e+l++
EcS656811.10 2 ILQQVPNDRRADAIHRLVYEANARENDPVNGRRGQLAQMIAEEERLQVPH 51
799*********************************99999999888755 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 8.55 | 1 | 55 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 3.6E-8 | 2 | 49 | IPR004883 | Lateral organ boundaries, LOB |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 55 aa Download sequence Send to blast |
EILQQVPNDR RADAIHRLVY EANARENDPV NGRRGQLAQM IAEEERLQVP HQAAG |
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| TrEMBL | A0A059AGU2 | 8e-29 | A0A059AGU2_EUCGR; Uncharacterized protein | ||||
| STRING | XP_010033333.1 | 1e-29 | (Eucalyptus grandis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM35076 | 2 | 2 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G16530.1 | 2e-08 | ASYMMETRIC LEAVES 2-like 9 | ||||




