PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EcS660768.10

Organism

Eucalyptus camaldulensis

Taxonomic ID

34316

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus

Family

NF-YB

Protein Properties

Length: 40aa MW: 4483.06 Da PI: 4.1529

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EcS660768.10	genome	ECGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	28.2	4.6e-09	1	38	50	87
NF-YB 50 asdkcqrekrktingddllwalatlGfedyveplkvyl 87 a+d c++ kr+tin+dd+l al ++ f +++ pl++ l EcS660768.10 1 ANDICKESKRQTINADDVLKALEEMEFPEFMGPLRASL 38 7999*****************************98766 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	7.2E-13	1	39	IPR009072	Histone-fold
SuperFamily	SSF47113	7.94E-12	1	39	IPR009072	Histone-fold

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 40 aa Download sequence Send to blast
ANDICKESKR QTINADDVLK ALEEMEFPEF MGPLRASLDG

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010031521.1	1e-20	PREDICTED: DNA polymerase epsilon subunit D
TrEMBL	A0A059A9S3	3e-19	A0A059A9S3_EUCGR; Uncharacterized protein
STRING	XP_010031521.1	5e-20	(Eucalyptus grandis)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G27470.1	4e-14	nuclear factor Y, subunit B11