![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EcS668258.10 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
| Family | Dof | ||||||||
| Protein Properties | Length: 37aa MW: 4432.03 Da PI: 8.7711 | ||||||||
| Description | Dof family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | zf-Dof | 67.9 | 1.6e-21 | 4 | 37 | 3 | 36 |
zf-Dof 3 ekalkcprCdstntkfCyynnyslsqPryfCkaC 36
++alkcprCds ntkfCyynny+lsqPr+fCk+C
EcS668258.10 4 HQALKCPRCDSLNTKFCYYNNYNLSQPRHFCKSC 37
7899****************************** PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD007478 | 3.0E-12 | 4 | 37 | IPR003851 | Zinc finger, Dof-type |
| Pfam | PF02701 | 2.7E-18 | 5 | 37 | IPR003851 | Zinc finger, Dof-type |
| PROSITE profile | PS50884 | 19.237 | 7 | 37 | IPR003851 | Zinc finger, Dof-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 37 aa Download sequence Send to blast |
HPNHQALKCP RCDSLNTKFC YYNNYNLSQP RHFCKSC |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Enhances the DNA binding of OBF transcription factors to OCS elements (By similarity). {ECO:0000250}. | |||||
| UniProt | Transcription factor that may transactivate seed storage protein genes in developing seeds. {ECO:0000250|UniProtKB:Q6K537}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by gibberellin. {ECO:0000269|PubMed:11470159}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_017973814.1 | 3e-22 | PREDICTED: dof zinc finger protein DOF5.4 isoform X1 | ||||
| Refseq | XP_021285636.1 | 5e-22 | LOW QUALITY PROTEIN: dof zinc finger protein DOF5.4 | ||||
| Swissprot | Q6Z345 | 1e-16 | DOF4_ORYSJ; Dof zinc finger protein 4 | ||||
| Swissprot | Q8LDR0 | 1e-16 | DOF54_ARATH; Dof zinc finger protein DOF5.4 | ||||
| TrEMBL | A0A061FXE2 | 1e-20 | A0A061FXE2_THECC; OBF binding protein 4, putative | ||||
| STRING | EOY22160 | 2e-21 | (Theobroma cacao) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G60850.1 | 5e-19 | OBF binding protein 4 | ||||




