![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EcS673217.10 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
| Family | G2-like | ||||||||
| Protein Properties | Length: 37aa MW: 4299.16 Da PI: 11.5503 | ||||||||
| Description | G2-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | G2-like | 46.6 | 7.3e-15 | 7 | 36 | 25 | 54 |
G2-like 25 ekAtPktilelmkvkgLtlehvkSHLQkYR 54
+AtPk +l+lm+v gLt++hvkSHLQ R
EcS673217.10 7 SEATPKMVLQLMDVRGLTISHVKSHLQVSR 36
57*************************866 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 1.9E-12 | 7 | 36 | IPR009057 | Homeodomain-like |
| TIGRFAMs | TIGR01557 | 1.3E-10 | 8 | 36 | IPR006447 | Myb domain, plants |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 37 aa Download sequence Send to blast |
ILFRFISEAT PKMVLQLMDV RGLTISHVKS HLQVSRF |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G14600.1 | 3e-11 | G2-like family protein | ||||




