PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EcS698880.10

Organism

Eucalyptus camaldulensis

Taxonomic ID

34316

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus

Family

MYB_related

Protein Properties

Length: 55aa MW: 6497.44 Da PI: 11.4757

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EcS698880.10	genome	ECGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	50.2	5.9e-16	2	46	3	47
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+eE+ l++ + ++lG+g+W+ Iar + Rt+ q+ s+ qky EcS698880.10 2 PWTEEEHRLFLTGLQKLGKGDWRGIARNYVTSRTPTQVASHAQKY 46 8*******************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00717	2.3E-8	1	49	IPR001005	SANT/Myb domain
TIGRFAMs	TIGR01557	1.2E-19	1	50	IPR006447	Myb domain, plants
PROSITE profile	PS51294	20.937	1	51	IPR017930	Myb domain
SuperFamily	SSF46689	2.01E-17	2	50	IPR009057	Homeodomain-like
Pfam	PF00249	2.2E-13	2	46	IPR001005	SANT/Myb domain
CDD	cd00167	3.23E-10	2	47	No hit	No description
Gene3D	G3DSA:1.10.10.60	5.4E-13	2	46	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 55 aa Download sequence Send to blast
VPWTEEEHRL FLTGLQKLGK GDWRGIARNY VTSRTPTQVA SHAQKYFIRQ TVIRR

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional repressor (PubMed:23888064, PubMed:24806884). Direct regulator of the transcription of peroxidase (Prxs) and reactive oxygen species (ROS)-related genes via the recognition of 5'-ATCACA-3' motif (PubMed:24806884). Binds to 5'-TATCCA-3' motif (TA box) and represses the activity of corresponding promoters (e.g. sugar response genes) (PubMed:25920996). Regulates hypocotyl elongation in response to darkness by enhancing auxin accumulation in a phytochrome-interacting factor (PIF) proteins-dependent manner. Promotes lateral roots formation (PubMed:23888064). Promotes cell expansion during leaves development via the modulation of cell wall-located Prxs (PubMed:24806884). Plays a critical role in developmentally regulated and dark-induced onset of leaf senescence by repressing the transcription of several genes involved in chloroplast function and responses to light and auxin. Promotes responses to auxin, abscisic acid (ABA), and ethylene (PubMed:25920996). {ECO:0000269\|PubMed:23888064, ECO:0000269\|PubMed:24806884, ECO:0000269\|PubMed:25920996}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Slightly induced by CdCl(2) (PubMed:16463103). Accumulates in the dark (PubMed:23888064, PubMed:25920996). Diurnal expression pattern with maximal levels in the morning (at protein level). Specifically induced during leaf expansion (PubMed:24806884). Expressed in old and dark-treated leaves (PubMed:25920996). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:23888064, ECO:0000269\|PubMed:24806884, ECO:0000269\|PubMed:25920996}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_022158465.1	3e-30	transcription factor KUA1
Refseq	XP_022965098.1	4e-30	transcription factor MYBS3
Refseq	XP_023552452.1	4e-30	transcription factor MYBS3
Swissprot	Q9LVS0	1e-28	KUA1_ARATH; Transcription factor KUA1
TrEMBL	G7ZLA3	8e-29	G7ZLA3_HUMLU; Myb transcription factor
STRING	XP_004147257.1	2e-29	(Cucumis sativus)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM20477	5	5

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G47390.1	6e-31	MYB_related family protein

Publications ? help Back to Top
Liu C,Wang B,Li Z,Peng Z,Zhang J TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth. Plant Physiol., 2018. 176(1): p. 742-756 [PMID:29122985]