![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EcS701937.10 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 89aa MW: 10361.7 Da PI: 6.5253 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 91.7 | 1.2e-28 | 12 | 88 | 2 | 79 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratk 79
ppGfrFhP+deel+ +yL++kv++ +l++ vi+++d+yk++Pw+Lpkk+ +e+ewyfFs+rd+ky++g r+nra++
EcS701937.10 12 PPGFRFHPSDEELIIHYLQNKVTSLPLPA-PVIADIDLYKYNPWELPKKALFGEDEWYFFSPRDRKYPNGGRPNRAAA 88
9***************************9.89***************88888999********************864 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 3.79E-34 | 7 | 87 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 32.83 | 11 | 89 | IPR003441 | NAC domain |
| Pfam | PF02365 | 6.1E-13 | 12 | 86 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 89 aa Download sequence Send to blast |
MEKESSSTFQ FPPGFRFHPS DEELIIHYLQ NKVTSLPLPA PVIADIDLYK YNPWELPKKA 60 LFGEDEWYFF SPRDRKYPNG GRPNRAAAS |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3ulx_A | 4e-38 | 2 | 89 | 6 | 93 | Stress-induced transcription factor NAC1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor of the NAC family associated with male fertility. {ECO:0000250}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018724402.1 | 5e-60 | PREDICTED: NAC domain-containing protein 18 | ||||
| Swissprot | A2YMR0 | 2e-40 | NAC10_ORYSI; NAC transcription factor ONAC010 | ||||
| TrEMBL | A0A059D550 | 3e-56 | A0A059D550_EUCGR; Uncharacterized protein | ||||
| STRING | VIT_06s0004g03080.t01 | 4e-50 | (Vitis vinifera) | ||||
| STRING | EOY33050 | 4e-50 | (Theobroma cacao) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM190 | 28 | 276 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G77450.1 | 2e-42 | NAC domain containing protein 32 | ||||




