PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EcS704717.10

Organism

Eucalyptus camaldulensis

Taxonomic ID

34316

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus

Family

MYB_related

Protein Properties

Length: 81aa MW: 9769.92 Da PI: 11.2562

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EcS704717.10	genome	ECGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	34.5	4.8e-11	1	37	11	48
HHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 11 llvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +l +v+ G+++W+ Ia++m gR +kqc++rw+++l EcS704717.10 1 RLMMLVETRGMKRWSQIAQMMK-GRVGKQCRERWHNHL 37 577799999**********9.***********97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	22.072	1	41	IPR017930	Myb domain
Pfam	PF00249	8.0E-10	1	37	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	8.97E-13	2	45	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	7.6E-17	2	42	IPR009057	Homeodomain-like
CDD	cd00167	9.72E-8	5	37	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 81 aa Download sequence Send to blast
RLMMLVETRG MKRWSQIAQM MKGRVGKQCR ERWHNHLRPD IKVFPLFFSF KFILPIICSI 60 FRLLPPLYLP LYEFTSTAIL I

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1gv2_A	1e-14	1	65	14	86	MYB PROTO-ONCOGENE PROTEIN
1h88_C	4e-14	1	65	68	140	MYB PROTO-ONCOGENE PROTEIN
1h89_C	4e-14	1	65	68	140	MYB PROTO-ONCOGENE PROTEIN
1mse_C	1e-14	1	65	14	86	C-Myb DNA-Binding Domain
1msf_C	1e-14	1	65	14	86	C-Myb DNA-Binding Domain
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that recognizes the motif 5'-TAACGG-3' in the promoter of endosperm-induced genes (PubMed:27681170, PubMed:25194028, PubMed:19066902). Promotes vegetative-to-embryonic transition and the formation of somatic embryos from root explants in a WUS-independent manner but via the expression of embryonic genes (e.g. LEC1, LEC2, FUS3 and WUS) (PubMed:18695688). May play an important role during embryogenesis and seed maturation (PubMed:19066902, PubMed:25194028). Together with MYB115, activates the transcription of S-ACP-DES2/AAD2 and S-ACP-DES3/AAD3 thus promoting the biosynthesis of omega-7 monounsaturated fatty acid in seed endosperm (PubMed:27681170). Regulates negatively maturation genes in the endosperm (PubMed:25194028). {ECO:0000269\|PubMed:18695688, ECO:0000269\|PubMed:19066902, ECO:0000269\|PubMed:25194028, ECO:0000269\|PubMed:27681170}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by LEC2. {ECO:0000269\|PubMed:25194028}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018717996.1	9e-24	PREDICTED: transcriptional activator Myb-like
Swissprot	Q9LVW4	7e-18	MY118_ARATH; Transcription factor MYB118
TrEMBL	A0A2G9HVJ7	7e-17	A0A2G9HVJ7_9LAMI; Transcription factor, Myb superfamily
STRING	XP_010030743.1	1e-22	(Eucalyptus grandis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM27405	3	3

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G27785.1	5e-20	myb domain protein 118

Publications ? help Back to Top
Troncoso-Ponce MA, et al. Transcriptional Activation of Two Delta-9 Palmitoyl-ACP Desaturase Genes by MYB115 and MYB118 Is Critical for Biosynthesis of Omega-7 Monounsaturated Fatty Acids in the Endosperm of Arabidopsis Seeds. Plant Cell, 2016. 28(10): p. 2666-2682 [PMID:27681170] Ettaki H, et al. Overexpression of MYB115, AAD2, or AAD3 in Arabidopsis thaliana seeds yields contrasting omega-7 contents. PLoS ONE, 2018. 13(1): p. e0192156 [PMID:29381741]