![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EcS725039.10 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 42aa MW: 4741.55 Da PI: 9.37 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 34 | 8.5e-11 | 9 | 38 | 1 | 30 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkklel 30
lp+GfrFhPtd+elv++yL +k++++ +++
EcS725039.10 9 LPAGFRFHPTDDELVNDYLIRKCASHAISV 38
79*********************9998765 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 2.48E-10 | 5 | 41 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 13.295 | 9 | 42 | IPR003441 | NAC domain |
| Pfam | PF02365 | 6.7E-7 | 10 | 32 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 42 aa Download sequence Send to blast |
KMKRAQLALP AGFRFHPTDD ELVNDYLIRK CASHAISVPF IA |
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010027566.1 | 1e-21 | PREDICTED: NAC domain-containing protein 2 | ||||
| TrEMBL | A0A059AKA7 | 3e-20 | A0A059AKA7_EUCGR; Uncharacterized protein | ||||
| STRING | XP_010027566.1 | 4e-21 | (Eucalyptus grandis) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G63790.1 | 9e-15 | NAC domain containing protein 102 | ||||




