![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EcS748128.10 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 86aa MW: 10108.4 Da PI: 10.6161 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 53.9 | 4e-17 | 1 | 43 | 1 | 45 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
+ WT+eEd++l++a+++ G++ W+ ++++ +Rt +++k++w+
EcS748128.10 1 KETWTEEEDKILIQAHTEIGNK-WSEMVKRLP-NRTQNSIKNHWN 43
578*******************.*********.***********8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF00249 | 5.6E-15 | 1 | 43 | IPR001005 | SANT/Myb domain |
| PROSITE profile | PS51294 | 22.709 | 1 | 50 | IPR017930 | Myb domain |
| SMART | SM00717 | 1.2E-11 | 1 | 48 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 8.97E-16 | 2 | 56 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 2.48E-9 | 3 | 46 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 1.0E-18 | 3 | 44 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 86 aa Download sequence Send to blast |
KETWTEEEDK ILIQAHTEIG NKWSEMVKRL PNRTQNSIKN HWNATKRRQY TNSSTSTSDL 60 DSLHQALMLS PRLVSFSIGK RKWNLP |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1idy_A | 7e-18 | 1 | 49 | 5 | 53 | MOUSE C-MYB DNA-BINDING DOMAIN REPEAT 3 |
| 1idz_A | 7e-18 | 1 | 49 | 5 | 53 | MOUSE C-MYB DNA-BINDING DOMAIN REPEAT 3 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds to the motif 5'-GTAACNT-3' in the promoter of target genes (e.g. DD11 and DD18) and promotes their expression within synergid cells (e.g. in the filiform apparatus) in ovules (PubMed:16214903, PubMed:17693534, PubMed:18410484, PubMed:17937500). Required for the formation of the filiform apparatus during synergid cell differentiation in the female gametophyte (PubMed:16214903). Involved in pollen tube guidance to the micropyle (PubMed:16214903, PubMed:17937500, PubMed:23093426). {ECO:0000269|PubMed:16214903, ECO:0000269|PubMed:17693534, ECO:0000269|PubMed:17937500, ECO:0000269|PubMed:18410484, ECO:0000269|PubMed:23093426}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_019432634.1 | 3e-24 | PREDICTED: transcription factor MYB98-like, partial | ||||
| Refseq | XP_020097178.1 | 1e-23 | transcription factor MYB115-like | ||||
| Refseq | XP_021825920.1 | 8e-24 | transcription factor MYB98-like | ||||
| Swissprot | Q9S7L2 | 6e-22 | MYB98_ARATH; Transcription factor MYB98 | ||||
| TrEMBL | A0A199UXC0 | 2e-22 | A0A199UXC0_ANACO; Transcription factor MYB98 | ||||
| TrEMBL | A0A2K3ND24 | 8e-23 | A0A2K3ND24_TRIPR; Transcription factor MYB 98-like protein (Fragment) | ||||
| STRING | XP_008239795.1 | 8e-23 | (Prunus mume) | ||||
| STRING | EMJ12343 | 6e-23 | (Prunus persica) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM13303 | 14 | 27 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G18770.1 | 6e-24 | myb domain protein 98 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




