PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EcS754350.20

Organism

Eucalyptus camaldulensis

Taxonomic ID

34316

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus

Family

NAC

Protein Properties

Length: 96aa MW: 11432.4 Da PI: 10.5823

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EcS754350.20	genome	ECGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	57.3	5.3e-18	36	83	1	49
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk 49 lp+GfrFhPtd+elv++yL +k++++++++ +i+e+d+yk++PwdLp EcS754350.20 36 LPAGFRFHPTDDELVNHYLIRKCASQSISV-PIIAEIDLYKFDPWDLPG 83 799*************************.88************94 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	7.59E-20	31	85	IPR003441	NAC domain
PROSITE profile	PS51005	19.722	36	96	IPR003441	NAC domain
Pfam	PF02365	5.4E-8	37	79	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 96 aa Download sequence Send to blast
WLRVRELSKF KARKKRARTR ESQKKTNRVE KRPLELPAGF RFHPTDDELV NHYLIRKCAS 60 QSISVPIIAE IDLYKFDPWD LPGTLRPFLC FSRLCC

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	1e-22	34	82	13	61	Stress-induced transcription factor NAC1
Search in ModeBase

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018732519.1	2e-52	PREDICTED: uncharacterized protein LOC104452408
Swissprot	Q39013	3e-24	NAC2_ARATH; NAC domain-containing protein 2
TrEMBL	A0A059AK49	7e-34	A0A059AK49_EUCGR; Uncharacterized protein (Fragment)
STRING	XP_002522919.1	3e-25	(Ricinus communis)
STRING	XP_010027540.1	2e-25	(Eucalyptus grandis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM7967	13	40

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G01720.1	1e-26	NAC family protein

Publications ? help Back to Top
Florentin A,Damri M,Grafi G Stress induces plant somatic cells to acquire some features of stem cells accompanied by selective chromatin reorganization. Dev. Dyn., 2013. 242(10): p. 1121-33 [PMID:23798027] Jensen MK, et al. ATAF1 transcription factor directly regulates abscisic acid biosynthetic gene NCED3 in Arabidopsis thaliana. FEBS Open Bio, 2013. 3: p. 321-7 [PMID:23951554] Wang YX Characterization of a novel Medicago sativa NAC transcription factor gene involved in response to drought stress. Mol. Biol. Rep., 2013. 40(11): p. 6451-8 [PMID:24057250] Yang X, et al. Overexpression of a Miscanthus lutarioriparius NAC gene MlNAC5 confers enhanced drought and cold tolerance in Arabidopsis. Plant Cell Rep., 2015. 34(6): p. 943-58 [PMID:25666276] Du Q,Wang H The role of HD-ZIP III transcription factors and miR165/166 in vascular development and secondary cell wall formation. Plant Signal Behav, 2015. 10(10): p. e1078955 [PMID:26340415] Takasaki H, et al. SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence. Plant J., 2015. 84(6): p. 1114-23 [PMID:26518251] Liu Y,Sun J,Wu Y Arabidopsis ATAF1 enhances the tolerance to salt stress and ABA in transgenic rice. J. Plant Res., 2016. 129(5): p. 955-962 [PMID:27216423] Ghandchi FP,Caetano-Anolles G,Clough SJ,Ort DR Investigating the Control of Chlorophyll Degradation by Genomic Correlation Mining. PLoS ONE, 2016. 11(9): p. e0162327 [PMID:27618630] Zhao J,Missihoun TD,Bartels D The ATAF1 transcription factor is a key regulator of aldehyde dehydrogenase 7B4 (ALDH7B4) gene expression in Arabidopsis thaliana. Planta, 2018. 248(4): p. 1017-1027 [PMID:30027414]