PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcS756886.10
Organism
Eucalyptus camaldulensis
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family NAC
Protein Properties Length: 80aa    MW: 9367.64 Da    PI: 4.6893
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcS756886.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM56.11.3e-171071163
           NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFsk 63
                  lp G+rFhPtdee v++yL+++v g   +   +i++vdi++++Pw+Lp+k+++e++  y F++
  EcS756886.10 10 LPIGYRFHPTDEEFVDHYLTNRVLGIVEDP-CIIPDVDICRWDPWELPQKFHGENRCHYHFAC 71
                  699*********************998666.57***************998887775566654 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.53E-19571IPR003441NAC domain
PROSITE profilePS5100517.7421080IPR003441NAC domain
PfamPF023651.4E-71170IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 80 aa     Download sequence    Send to blast
MGAVIIPQNL PIGYRFHPTD EEFVDHYLTN RVLGIVEDPC IIPDVDICRW DPWELPQKFH  60
GENRCHYHFA CSFDTISLQP
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (PubMed:18443413, PubMed:24329768). Calmodulin-regulated transcriptional repressor. Binds several synthetic promoters with randomly selected binding sites (PubMed:17947243). Functions synergistically with SNI1 as negative regulator of pathogen-induced PR1 expression and basal resistance to a virulent strain of P.syringae. Binds directly to the promoter of the PR1 gene (PubMed:22826500). Acts as positive regulator of innate immunity. Involved in the effector-triggered immunity (ETI) induction of immunity-related gene expression (PubMed:24329768). Mediates osmotic stress signaling in leaf senescence by up-regulating senescence-associated genes (PubMed:18443413). {ECO:0000269|PubMed:17947243, ECO:0000269|PubMed:18443413, ECO:0000269|PubMed:22826500, ECO:0000269|PubMed:24329768}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010065766.17e-41PREDICTED: NAC domain-containing protein 37
SwissprotF4JN351e-16NTL9_ARATH; Protein NTM1-like 9
TrEMBLA0A059BC531e-39A0A059BC53_EUCGR; Uncharacterized protein
STRINGXP_010065766.12e-40(Eucalyptus grandis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79671340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35580.25e-19NAC transcription factor-like 9
Publications ? help Back to Top
  1. Zheng XY, et al.
    Spatial and temporal regulation of biosynthesis of the plant immune signal salicylic acid.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(30): p. 9166-73
    [PMID:26139525]
  2. Guo T, et al.
    Lamin-like Proteins Negatively Regulate Plant Immunity through NAC WITH TRANSMEMBRANE MOTIF1-LIKE9 and NONEXPRESSOR OF PR GENES1 in Arabidopsis thaliana.
    Mol Plant, 2017. 10(10): p. 1334-1348
    [PMID:28943325]