![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EcS766893.10 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 51aa MW: 5868.89 Da PI: 9.1585 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 82.1 | 3.5e-26 | 1 | 41 | 11 | 51 |
HHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 11 vtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
vtfskRr+g+lKKA+ELSvLCdaeva+iifs++g+lye+ss
EcS766893.10 1 VTFSKRRTGLLKKAYELSVLCDAEVAMIIFSQKGRLYEFSS 41
8**************************************96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 23.324 | 1 | 43 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 1.6E-22 | 1 | 39 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 2.88E-21 | 1 | 45 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 1.0E-17 | 1 | 42 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 9.4E-19 | 5 | 20 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 9.4E-19 | 20 | 41 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 51 aa Download sequence Send to blast |
VTFSKRRTGL LKKAYELSVL CDAEVAMIIF SQKGRLYEFS SNSEYVHILI L |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | MADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}. | |||||
| UniProt | Probable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers. | |||||
| UniProt | Transcriptional activator that regulates root development by controlling meristem size and patterning of the root apical meristem. Regulates auxin transport and gradients in the root meristematic cells via direct regulation of the auxin efflux carrier PIN1 and PIN4 gene expression. Binds specifically to the CArG-box DNA sequences in the promoter regions of PIN1 and PIN4 genes (PubMed:24121311). Involved in the regulation of shoot apical meristem (SAM) cell identities and transitions. Promotes flowering transition and participates in flower meristem maintenance and determinacy. Positively regulates TFL1 and WUS expression. Binds directly to the TFL1 regulatory sequences (PubMed:25636918). {ECO:0000269|PubMed:24121311}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By auxin. {ECO:0000269|PubMed:24121311}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010035067.1 | 3e-23 | PREDICTED: MADS-box protein AGL42 | ||||
| Swissprot | Q01540 | 1e-18 | AG_BRANA; Floral homeotic protein AGAMOUS | ||||
| Swissprot | Q38838 | 8e-19 | AGL14_ARATH; Agamous-like MADS-box protein AGL14 | ||||
| Swissprot | Q9FIS1 | 6e-19 | AGL42_ARATH; MADS-box protein AGL42 | ||||
| TrEMBL | A0A058ZX09 | 2e-23 | A0A058ZX09_EUCGR; Uncharacterized protein | ||||
| TrEMBL | A0A058ZY83 | 6e-22 | A0A058ZY83_EUCGR; Uncharacterized protein | ||||
| STRING | XP_010035067.1 | 1e-22 | (Eucalyptus grandis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM78 | 28 | 413 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G62165.4 | 2e-21 | AGAMOUS-like 42 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




