 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
EcS780312.10 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
| Family |
ERF |
| Protein Properties |
Length: 69aa MW: 7983.12 Da PI: 11.4867 |
| Description |
ERF family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| EcS780312.10 | genome | ECGD | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | AP2 | 45.4 | 2e-14 | 1 | 42 | 12 | 55 |
AP2 12 rgrWvAeIrdpsengkrkrfslgkfgtaeeAakaaiaarkkleg 55
+g+++AeIrdp++ng +r +lg++ t++eAa a+++a+ +++g
EcS780312.10 1 QGKYAAEIRDPKKNG--ARRWLGTYQTPQEAALAYDRAAFAMRG 42
69*********9998..*************************98 PP
|
| Gene Ontology ? help Back to Top |
| GO Term |
GO Category |
GO Description |
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
| GO:0003677 | Molecular Function | DNA binding |
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Probably acts as a transcriptional activator and may be involved in disease resistance pathways (By similarity). Binds to the GCC-box pathogenesis-related promoter element. Involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways mediated by ethylene, that seems to depend on a protein kinase cascade and to be influenced by methyl-jasmonate. {ECO:0000250, ECO:0000269|PubMed:7756828, ECO:0000269|Ref.2}. |
| Regulation -- Description ? help
Back to Top |
| Source |
Description |
| UniProt | INDUCTION: Highly and transiently expressed in tobacco mosaic virus (TMV) infected leaves. Induced by methyl-jasmonate (MeJA), and by ethephon (ethylene-releasing compound) in buds and to lower extent in leaves. Quickly and transiently induced by salicylic acid (SA). Strongly induced by wounding, independently of ethylene, and through a de-novo-protein-synthesis-independent regulation. Wound induction is reduced by MeJA. Also induced by acetyl salicylic acid (ASA), cycloheximide, auxin (2,4-D), and benzoic acid (BA) but seems to not be influenced by 4-hydroxybenzoic acid (4HBA), thiamine, H(2)O(2) or abscisic acid (ABA). {ECO:0000269|PubMed:7756828, ECO:0000269|PubMed:9725022, ECO:0000269|Ref.2}. |
| Best hit in Arabidopsis thaliana ? help
Back to Top |
| Hit ID |
E-value |
Description |
| AT2G44840.1 | 6e-30 | ethylene-responsive element binding factor 13 |