![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EcS785391.10 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
| Family | Whirly | ||||||||
| Protein Properties | Length: 100aa MW: 11216.7 Da PI: 8.509 | ||||||||
| Description | Whirly family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Whirly | 81.5 | 1.2e-25 | 1 | 60 | 78 | 137 |
Whirly 78 hdpaakgsneGkvrkalkvePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsl 137
hdp++ +sn+G+vrk+l+++P++dG G+f++lsv+n+++k+ne+f+vPv+ aefav++++
EcS785391.10 1 HDPSMLSSNAGQVRKSLSIKPHADGGGYFISLSVNNNILKTNERFTVPVTAAEFAVMKTA 60
9*********************************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.30.31.10 | 1.4E-31 | 1 | 82 | IPR009044 | ssDNA-binding transcriptional regulator |
| SuperFamily | SSF54447 | 3.37E-30 | 1 | 98 | IPR009044 | ssDNA-binding transcriptional regulator |
| Pfam | PF08536 | 2.7E-21 | 1 | 59 | IPR013742 | Plant transcription factor |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 100 aa Download sequence Send to blast |
HDPSMLSSNA GQVRKSLSIK PHADGGGYFI SLSVNNNILK TNERFTVPVT AAEFAVMKTA 60 CSFALPHIMG WDRYTNNQRH RAEESPSKVD KQILDLEWDK |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3n1h_A | 2e-43 | 1 | 76 | 93 | 168 | StWhy2 |
| 3n1i_A | 2e-43 | 1 | 76 | 93 | 168 | protein StWhy2 |
| 3n1j_A | 2e-43 | 1 | 76 | 93 | 168 | Protein StWhy2 |
| 3n1k_A | 2e-43 | 1 | 76 | 93 | 168 | protein StWhy2 |
| 3n1l_A | 2e-43 | 1 | 76 | 93 | 168 | protein StWhy2 |
| 3r9y_A | 2e-43 | 1 | 76 | 93 | 168 | Why2 protein |
| 3r9z_A | 2e-43 | 1 | 76 | 93 | 168 | Why2 protein |
| 3ra0_A | 2e-43 | 1 | 76 | 93 | 168 | Why2 protein |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Single-stranded DNA-binding protein that may be involved in the maintenance of mitochondrial genome stability by preventing break-induced DNA rearrangements. {ECO:0000269|PubMed:21911368}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010035836.1 | 2e-68 | PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial | ||||
| Swissprot | D9J034 | 5e-50 | WHY2_SOLTU; Single-stranded DNA-binding protein WHY2, mitochondrial | ||||
| TrEMBL | A0A059A1U8 | 9e-68 | A0A059A1U8_EUCGR; Uncharacterized protein | ||||
| STRING | XP_010035836.1 | 8e-68 | (Eucalyptus grandis) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G71260.1 | 2e-45 | WHIRLY 2 | ||||




