![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Eucgr.A01168.1.p | ||||||||
| Common Name | EUGRSUZ_A01168, LOC104435758 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
| Family | S1Fa-like | ||||||||
| Protein Properties | Length: 85aa MW: 9120.84 Da PI: 10.19 | ||||||||
| Description | S1Fa-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | S1FA | 132.4 | 1.2e-41 | 19 | 84 | 5 | 70 |
S1FA 5 kveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
+++a G+nPGlivll+v+glll+flvgny+lyvyaqk+lPP+kkkPvskkk+kreklkqGv++PGe
Eucgr.A01168.1.p 19 AADAGGFNPGLIVLLLVAGLLLIFLVGNYVLYVYAQKTLPPKKKKPVSKKKMKREKLKQGVSAPGE 84
56889************************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF04689 | 3.2E-39 | 21 | 84 | IPR006779 | DNA binding protein S1FA |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0016021 | Cellular Component | integral component of membrane | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 85 aa Download sequence Send to blast |
MAEDFEFADQ VPPSFDGKAA DAGGFNPGLI VLLLVAGLLL IFLVGNYVLY VYAQKTLPPK 60 KKKPVSKKKM KREKLKQGVS APGE* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Eucgr.A01168.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010046757.1 | 4e-53 | PREDICTED: DNA-binding protein S1FA | ||||
| Swissprot | Q7XLX6 | 1e-14 | S1FA2_ORYSJ; DNA-binding protein S1FA2 | ||||
| TrEMBL | A0A059DF13 | 9e-52 | A0A059DF13_EUCGR; Uncharacterized protein | ||||
| STRING | XP_010046757.1 | 2e-52 | (Eucalyptus grandis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM2823 | 27 | 69 |
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Eucgr.A01168.1.p |
| Entrez Gene | 104435758 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




