![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Eucgr.B01293.1.p | ||||||||
| Common Name | EUGRSUZ_B01293 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 121aa MW: 13647.5 Da PI: 5.9674 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 164.6 | 1.3e-51 | 13 | 108 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94
+eqdr+lPianv+rimk+++P nakisk+aket+q+cvsefi+fvtseas+kc+re+rkt+ngdd++ a+ tlGf+dy+ l+ yl++yrele
Eucgr.B01293.1.p 13 KEQDRLLPIANVGRIMKQIVPPNAKISKEAKETMQDCVSEFIGFVTSEASEKCRRERRKTVNGDDICCAMETLGFDDYAGMLRRYLHRYRELE 105
89******************************************************************************************* PP
NF-YB 95 gek 97
gek
Eucgr.B01293.1.p 106 GEK 108
*97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 4.2E-49 | 10 | 118 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 9.03E-38 | 15 | 118 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 2.0E-26 | 18 | 82 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 2.0E-15 | 46 | 64 | No hit | No description |
| PRINTS | PR00615 | 2.0E-15 | 65 | 83 | No hit | No description |
| PRINTS | PR00615 | 2.0E-15 | 84 | 102 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 121 aa Download sequence Send to blast |
MVDNIGANDG SIKEQDRLLP IANVGRIMKQ IVPPNAKISK EAKETMQDCV SEFIGFVTSE 60 ASEKCRRERR KTVNGDDICC AMETLGFDDY AGMLRRYLHR YRELEGEKAN QDKAMNNTEK 120 * |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 3e-43 | 12 | 103 | 1 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 3e-43 | 12 | 103 | 1 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Eucgr.B01293.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010037376.1 | 2e-71 | PREDICTED: nuclear transcription factor Y subunit B-5 | ||||
| Swissprot | O82248 | 2e-55 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
| TrEMBL | A0A059D1L5 | 4e-84 | A0A059D1L5_EUCGR; Uncharacterized protein | ||||
| STRING | XP_010037234.1 | 5e-85 | (Eucalyptus grandis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM255 | 28 | 229 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G47810.1 | 8e-48 | nuclear factor Y, subunit B5 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Eucgr.B01293.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




