PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Eucgr.B01299.1.p

Common Name

EUGRSUZ_B01300

Organism

Eucalyptus grandis

Taxonomic ID

71139

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus

Family

NF-YB

Protein Properties

Length: 94aa MW: 10639.2 Da PI: 8.3203

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Eucgr.B01299.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	125.2	2.5e-39	1	81	17	97
NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 mk+vlP nakisk++ket+qecvsefi+fvtseas+kc++e+rkt+ngdd++ a+ t+Gf+dy+ l+ yl+ yr legek Eucgr.B01299.1.p 1 MKQVLPPNAKISKQTKETMQECVSEFIGFVTSEASEKCRKERRKTVNGDDICCAMETMGFDDYAGLLRRYLHIYRGLEGEK 81 9*****************************************************************************997 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF00808	1.2E-18	1	55	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
SuperFamily	SSF47113	6.2E-28	1	90	IPR009072	Histone-fold
Gene3D	G3DSA:1.10.20.10	6.5E-36	1	91	IPR009072	Histone-fold
PRINTS	PR00615	4.0E-14	19	37	No hit	No description
PRINTS	PR00615	4.0E-14	38	56	No hit	No description
PRINTS	PR00615	4.0E-14	57	75	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 94 aa Download sequence Send to blast
MKQVLPPNAK ISKQTKETMQ ECVSEFIGFV TSEASEKCRK ERRKTVNGDD ICCAMETMGF 60 DDYAGLLRRY LHIYRGLEGE KANQVKAMNN TQQ*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	1e-30	1	75	17	91	Transcription factor HapC (Eurofung)
4g92_B	1e-30	1	75	17	91	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Eucgr.B01299.1.p

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010037376.1	2e-49	PREDICTED: nuclear transcription factor Y subunit B-5
Swissprot	O82248	2e-41	NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBL	A0A059D1Z0	7e-64	A0A059D1Z0_EUCGR; Uncharacterized protein
TrEMBL	A0A059D2P9	1e-63	A0A059D2P9_EUCGR; Uncharacterized protein
STRING	XP_010037234.1	2e-55	(Eucalyptus grandis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM255	28	229

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G47810.1	1e-43	nuclear factor Y, subunit B5

Link Out ? help Back to Top
Phytozome	Eucgr.B01299.1.p

Publications ? help Back to Top
Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]