![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Eucgr.C01264.1.p | ||||||||
| Common Name | EUGRSUZ_C01264 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 136aa MW: 15532.7 Da PI: 7.9122 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 80.2 | 4.6e-25 | 6 | 123 | 6 | 128 |
NAM 6 rFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98
+++Ptde l+++yL++kv gk+l+l i+e+d+y+ ePw++ +++ + ++ y F++ k g+r++r++ sg+Wk + ++ ++++ +g
Eucgr.C01264.1.p 6 KYRPTDECLITDYLQPKVMGKPLPL-GQIDECDLYSQEPWKIFNTTLELKQTFYVFTELTK---MGSRNSRTVGSGTWKGQHRT-KIFNDGGD 93
799**********************.78**************7433333445577777655...589************99885.56666999 PP
NAM 99 lvglkktLvfykgrapkgektdWvmheyrl 128
g kk++ f +g p++++ +W+m+e+++
Eucgr.C01264.1.p 94 FLGYKKSFKFQEGGGPSATSGRWIMKEFSM 123
****************************86 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51005 | 27.987 | 1 | 135 | IPR003441 | NAC domain |
| Pfam | PF02365 | 2.3E-15 | 6 | 122 | IPR003441 | NAC domain |
| SuperFamily | SSF101941 | 3.14E-28 | 6 | 133 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 136 aa Download sequence Send to blast |
MNSLAKYRPT DECLITDYLQ PKVMGKPLPL GQIDECDLYS QEPWKIFNTT LELKQTFYVF 60 TELTKMGSRN SRTVGSGTWK GQHRTKIFND GGDFLGYKKS FKFQEGGGPS ATSGRWIMKE 120 FSMCDEREEW FLCVG* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 4e-18 | 6 | 133 | 22 | 160 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 4e-18 | 6 | 133 | 22 | 160 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 4e-18 | 6 | 133 | 22 | 160 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 4e-18 | 6 | 133 | 22 | 160 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 5e-18 | 6 | 133 | 25 | 163 | NAC domain-containing protein 19 |
| 3swm_B | 5e-18 | 6 | 133 | 25 | 163 | NAC domain-containing protein 19 |
| 3swm_C | 5e-18 | 6 | 133 | 25 | 163 | NAC domain-containing protein 19 |
| 3swm_D | 5e-18 | 6 | 133 | 25 | 163 | NAC domain-containing protein 19 |
| 3swp_A | 5e-18 | 6 | 133 | 25 | 163 | NAC domain-containing protein 19 |
| 3swp_B | 5e-18 | 6 | 133 | 25 | 163 | NAC domain-containing protein 19 |
| 3swp_C | 5e-18 | 6 | 133 | 25 | 163 | NAC domain-containing protein 19 |
| 3swp_D | 5e-18 | 6 | 133 | 25 | 163 | NAC domain-containing protein 19 |
| 4dul_A | 4e-18 | 6 | 133 | 22 | 160 | NAC domain-containing protein 19 |
| 4dul_B | 4e-18 | 6 | 133 | 22 | 160 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Eucgr.C01264.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010050567.1 | 4e-91 | PREDICTED: NAC domain-containing protein 67 | ||||
| TrEMBL | A0A059CNL1 | 2e-96 | A0A059CNL1_EUCGR; Uncharacterized protein | ||||
| STRING | XP_010050567.1 | 1e-90 | (Eucalyptus grandis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM13343 | 7 | 27 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G10480.2 | 2e-20 | NAC domain containing protein 50 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Eucgr.C01264.1.p |




