![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Eucgr.D02326.1.p | ||||||||
| Common Name | EUGRSUZ_D02326 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 124aa MW: 14350.3 Da PI: 10.591 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 104.1 | 7.4e-33 | 40 | 98 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
ldDg++WrKYGqK vk+s++prsYYrC++ C+vkk+v+r +ed+++v++tYeg Hnh+
Eucgr.D02326.1.p 40 LDDGFRWRKYGQKAVKNSTHPRSYYRCAHIACNVKKQVQRLSEDTSIVVTTYEGIHNHP 98
59********************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.20.25.80 | 1.0E-33 | 27 | 99 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 3.92E-29 | 32 | 99 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 28.449 | 35 | 100 | IPR003657 | WRKY domain |
| SMART | SM00774 | 2.2E-38 | 40 | 99 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 2.6E-26 | 41 | 98 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 124 aa Download sequence Send to blast |
MEEIRARRLE KRSKAAASSR ARKAASPRFE FQTRSEDDLL DDGFRWRKYG QKAVKNSTHP 60 RSYYRCAHIA CNVKKQVQRL SEDTSIVVTT YEGIHNHPSE KIMETLSPLL RQIQLLSRFS 120 PDK* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 2e-26 | 31 | 97 | 8 | 74 | Probable WRKY transcription factor 4 |
| 2lex_A | 2e-26 | 31 | 97 | 8 | 74 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Eucgr.D02326.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010053764.1 | 3e-87 | PREDICTED: probable WRKY transcription factor 75 | ||||
| Swissprot | Q8GY11 | 5e-52 | WRK43_ARATH; Probable WRKY transcription factor 43 | ||||
| Swissprot | Q8VWQ4 | 4e-51 | WRK56_ARATH; Probable WRKY transcription factor 56 | ||||
| Swissprot | Q9FFS3 | 2e-51 | WRK24_ARATH; Probable WRKY transcription factor 24 | ||||
| TrEMBL | A0A059CI98 | 1e-86 | A0A059CI98_EUCGR; Uncharacterized protein | ||||
| STRING | XP_010053764.1 | 1e-86 | (Eucalyptus grandis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM509 | 28 | 154 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G64000.1 | 2e-51 | WRKY DNA-binding protein 56 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Eucgr.D02326.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




