PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Eucgr.D02474.1.p

Common Name

EUGRSUZ_D02474, LOC104442258

Organism

Eucalyptus grandis

Taxonomic ID

71139

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus

Family

YABBY

Protein Properties

Length: 223aa MW: 24568 Da PI: 8.3047

Description

YABBY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Eucgr.D02474.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	YABBY	240.5	3.5e-74	21	185	2	170
YABBY 2 dvfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkee....lleelkveeenlksnvekee 90 ++ s +eq+Cyv+Cn+C+t+lavsvP tslfk+vtvrCGhCt+llsvn++ + ll++ ++l+ + llee +++ +l n+ Eucgr.D02474.1.p 21 HLSSPTEQLCYVHCNYCDTVLAVSVPCTSLFKTVTVRCGHCTNLLSVNMRGM--LLPSANQLQLGHNYFtpqnLLEEIRNAPPSLLINQL--- 108 567899**************************************776665..566666655544443112355555555555544444... PP YABBY 91 sastsvsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170 s+ s+ + + e++p++p v+rPPekrqrvPsaynrfikeeiqrika+nPdishreafsaaaknWahfP+ihfgl Eucgr.D02474.1.p 109 SPADSIMQ---LRGGAEQIPKPPVVNRPPEKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGL 185 33333333...3467899999*****************************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF04690	2.6E-72	25	185	IPR006780	YABBY protein
SuperFamily	SSF47095	4.45E-8	128	178	IPR009071	High mobility group box domain
Gene3D	G3DSA:1.10.30.10	7.7E-5	133	179	IPR009071	High mobility group box domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0007275	Biological Process	multicellular organism development

Sequence ? help Back to Top
Protein Sequence Length: 223 aa Download sequence Send to blast
MNMMSSSSSS SSGFAPDHHH HLSSPTEQLC YVHCNYCDTV LAVSVPCTSL FKTVTVRCGH 60 CTNLLSVNMR GMLLPSANQL QLGHNYFTPQ NLLEEIRNAP PSLLINQLSP ADSIMQLRGG 120 AEQIPKPPVV NRPPEKRQRV PSAYNRFIKE EIQRIKAGNP DISHREAFSA AAKNWAHFPH 180 IHFGLMPDQP VKKTNICQQE GEDVLRKDGG LFATANVGVS PY*

Functional Description ? help Back to Top
Source	Description
UniProt	Involved in the abaxial cell fate determination during embryogenesis and organogenesis. Regulates the initiation of embryonic shoot apical meristem (SAM) development (PubMed:10323860, PubMed:10331982, PubMed:10457020, PubMed:11812777, PubMed:12417699, PubMed:9878633, Ref.3, Ref.6, PubMed:19837869). Required during flower formation and development, particularly for the patterning of floral organs. Positive regulator of class B (AP3 and PI) activity in whorls 2 and 3. Negative regulator of class B activity in whorl 1 and of SUP activity in whorl 3. Interacts with class A proteins (AP1, AP2 and LUG) to repress class C (AG) activity in whorls 1 and 2. Contributes to the repression of KNOX genes (STM, KNAT1/BP and KNAT2) to avoid ectopic meristems. Binds DNA without sequence specificity. In vitro, can compete and displace the AP1 protein binding to DNA containing CArG box (PubMed:10323860, PubMed:10331982, PubMed:10457020, PubMed:11812777, PubMed:12417699, PubMed:9878633, Ref.3, Ref.6). {ECO:0000269\|PubMed:10323860, ECO:0000269\|PubMed:10331982, ECO:0000269\|PubMed:10457020, ECO:0000269\|PubMed:11812777, ECO:0000269\|PubMed:12417699, ECO:0000269\|PubMed:19837869, ECO:0000269\|PubMed:9878633, ECO:0000269\|Ref.3, ECO:0000269\|Ref.6}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Eucgr.D02474.1.p

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010053914.1	1e-167	PREDICTED: axial regulator YABBY 1
Swissprot	O22152	2e-93	YAB1_ARATH; Axial regulator YABBY 1
TrEMBL	A0A059CJD3	1e-166	A0A059CJD3_EUCGR; Uncharacterized protein
STRING	XP_010053914.1	1e-166	(Eucalyptus grandis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM2217	28	77

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G45190.1	3e-95	YABBY family protein

Link Out ? help Back to Top
Phytozome	Eucgr.D02474.1.p
Entrez Gene	104442258

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Lian H,Li X,Liu Z,He Y HYL1 is required for establishment of stamen architecture with four microsporangia in Arabidopsis. J. Exp. Bot., 2013. 64(11): p. 3397-410 [PMID:23918970] Tameshige T, et al. Pattern dynamics in adaxial-abaxial specific gene expression are modulated by a plastid retrograde signal during Arabidopsis thaliana leaf development. PLoS Genet., 2013. 9(7): p. e1003655 [PMID:23935517] Boter M, et al. FILAMENTOUS FLOWER Is a Direct Target of JAZ3 and Modulates Responses to Jasmonate. Plant Cell, 2015. 27(11): p. 3160-74 [PMID:26530088] Douglas SJ,Li B,Kliebenstein DJ,Nambara E,Riggs CD A novel Filamentous Flower mutant suppresses brevipedicellus developmental defects and modulates glucosinolate and auxin levels. PLoS ONE, 2017. 12(5): p. e0177045 [PMID:28493925] Tanaka W,Toriba T,Hirano HY Three TOB1-related YABBY genes are required to maintain proper function of the spikelet and branch meristems in rice. New Phytol., 2017. 215(2): p. 825-839 [PMID:28556940] Silverblatt-Buser EW,Frick MA,Rabeler C,Kaplinsky NJ Genetic Interactions Between BOB1 and Multiple 26S Proteasome Subunits Suggest a Role for Proteostasis in Regulating Arabidopsis Development. G3 (Bethesda), 2018. 8(4): p. 1379-1390 [PMID:29487187]