![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Eucgr.E02056.1.p | ||||||||
| Common Name | EUGRSUZ_E02056 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 71aa MW: 7648.8 Da PI: 8.2286 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 54.1 | 4.6e-17 | 15 | 62 | 1 | 48 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllka 48
+C Ck+ +r+Ca+dCv+ap pa++p+kfanvh++FGasnv k+ +
Eucgr.E02056.1.p 15 PCTLCKLPQRRCAQDCVFAPNCPADEPHKFANVHEVFGASNVNKMFQV 62
7********************************************985 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 14.613 | 14 | 70 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 5.5E-16 | 15 | 61 | IPR004883 | Lateral organ boundaries, LOB |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 71 aa Download sequence Send to blast |
MKESGGGWKQ GMPSPCTLCK LPQRRCAQDC VFAPNCPADE PHKFANVHEV FGASNVNKMF 60 QVTHLISSSV * |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 2e-14 | 11 | 60 | 7 | 56 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 2e-14 | 11 | 60 | 7 | 56 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Eucgr.E02056.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010058727.1 | 8e-40 | PREDICTED: B3 domain-containing protein At2g33720 | ||||
| Swissprot | Q9SHE9 | 6e-24 | LBD4_ARATH; LOB domain-containing protein 4 | ||||
| TrEMBL | A0A059C5B2 | 1e-45 | A0A059C5B2_EUCGR; Uncharacterized protein | ||||
| STRING | XP_010058727.1 | 3e-39 | (Eucalyptus grandis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM12282 | 14 | 32 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G31320.1 | 3e-26 | LOB domain-containing protein 4 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Eucgr.E02056.1.p |




