![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Eucgr.F02146.9.p | ||||||||
| Common Name | EUGRSUZ_F02146 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 160aa MW: 18265.3 Da PI: 10.1443 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 85.1 | 4.3e-27 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
k+i+n + r vtfskRr g++KKA+ELSvLCda+v++iifs tgklye+ss
Eucgr.F02146.9.p 9 KKIDNVMARRVTFSKRRRGLIKKAQELSVLCDADVSLIIFSATGKLYEFSS 59
689**********************************************96 PP
| |||||||
| 2 | K-box | 35.6 | 4e-13 | 87 | 157 | 15 | 85 |
K-box 15 eslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkek 85
++ + +l+ L+ke++ ++R+++GedLe+L+++ L+qLe++Le +l+ + ++ +e ++i+elq k +
Eucgr.F02146.9.p 87 QKDSSNLEMLRKEVNDKAYKLRQMKGEDLERLDVEGLRQLEKKLEAGLSLVIKTEEERASTKINELQGKVR 157
66778888999999999999***********************************************9976 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 1.6E-35 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 29.857 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 4.39E-36 | 2 | 69 | No hit | No description |
| SuperFamily | SSF55455 | 1.14E-30 | 2 | 74 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.5E-26 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 6.8E-23 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.5E-26 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.5E-26 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS51297 | 9.69 | 86 | 159 | IPR002487 | Transcription factor, K-box |
| Pfam | PF01486 | 9.7E-10 | 89 | 156 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 160 aa Download sequence Send to blast |
MGREKIKIKK IDNVMARRVT FSKRRRGLIK KAQELSVLCD ADVSLIIFSA TGKLYEFSSS 60 SMEDTLTRYV LHSNIVEKPV QPCLSLQKDS SNLEMLRKEV NDKAYKLRQM KGEDLERLDV 120 EGLRQLEKKL EAGLSLVIKT EEERASTKIN ELQGKVRVH* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5f28_A | 1e-19 | 1 | 73 | 1 | 73 | MEF2C |
| 5f28_B | 1e-19 | 1 | 73 | 1 | 73 | MEF2C |
| 5f28_C | 1e-19 | 1 | 73 | 1 | 73 | MEF2C |
| 5f28_D | 1e-19 | 1 | 73 | 1 | 73 | MEF2C |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription repressor that inhibit floral transition in the autonomous flowering pathway, independent of photoperiod and temperature. Acts in a dosage-dependent manner. Together with AGL24 and AP1, controls the identity of the floral meristem and regulates expression of class B, C and E genes. Promotes EFM expression to suppress flowering (PubMed:25132385). {ECO:0000269|PubMed:16679456, ECO:0000269|PubMed:18694458, ECO:0000269|PubMed:19656343, ECO:0000269|PubMed:25132385}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Eucgr.F02146.9.p |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Repressed by the floral homeotic genes AP1 and SEP3 in emerging floral meristems. Up-regulated by HUA2. {ECO:0000269|PubMed:15659097, ECO:0000269|PubMed:17428825, ECO:0000269|PubMed:18694458}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018731853.1 | 1e-106 | PREDICTED: MADS-box protein AGL24 isoform X1 | ||||
| Refseq | XP_018731854.1 | 1e-107 | PREDICTED: MADS-box protein SVP isoform X2 | ||||
| Refseq | XP_018731855.1 | 1e-107 | PREDICTED: MADS-box protein SVP isoform X2 | ||||
| Swissprot | Q9FVC1 | 5e-56 | SVP_ARATH; MADS-box protein SVP | ||||
| TrEMBL | A0A059BS88 | 1e-110 | A0A059BS88_EUCGR; Uncharacterized protein | ||||
| STRING | XP_010061535.1 | 1e-104 | (Eucalyptus grandis) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G22540.1 | 2e-58 | MIKC_MADS family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Eucgr.F02146.9.p |




