![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Eucgr.F02843.1.p | ||||||||
| Common Name | EUGRSUZ_F02843 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 84aa MW: 9848.42 Da PI: 10.2656 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 60.2 | 4.5e-19 | 9 | 56 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WT+eEd ll++ v+++G g W+ ++r+ g++R++k+c++rw++yl
Eucgr.F02843.1.p 9 KGAWTEEEDALLKEWVEKYGEGKWHQVPRRAGLNRCRKSCRLRWLNYL 56
79*********************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 25.982 | 4 | 60 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 2.4E-23 | 6 | 59 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 8.1E-16 | 8 | 58 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 1.5E-17 | 9 | 56 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 5.13E-23 | 10 | 83 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 4.46E-11 | 11 | 56 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 3.7E-7 | 60 | 83 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 84 aa Download sequence Send to blast |
MEGAIGVRKG AWTEEEDALL KEWVEKYGEG KWHQVPRRAG LNRCRKSCRL RWLNYLKPNI 60 KRGAFQEDEV DMIIRLHKLL GNR* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1a5j_A | 2e-13 | 3 | 83 | 1 | 80 | B-MYB |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator, when associated with BHLH002/EGL3/MYC146, BHLH012/MYC1, or BHLH042/TT8. {ECO:0000269|PubMed:15361138}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Eucgr.F02843.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010064837.1 | 7e-54 | PREDICTED: transcription factor MYB90 | ||||
| Swissprot | Q9FNV9 | 2e-38 | MY113_ARATH; Transcription factor MYB113 | ||||
| TrEMBL | A0A059BUP6 | 1e-53 | A0A059BUP6_EUCGR; Uncharacterized protein | ||||
| STRING | XP_010064837.1 | 3e-53 | (Eucalyptus grandis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM4 | 28 | 2646 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G66370.1 | 7e-41 | myb domain protein 113 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Eucgr.F02843.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




