PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Eucgr.G01639.1.p

Common Name

EUGRSUZ_G01639

Organism

Eucalyptus grandis

Taxonomic ID

71139

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus

Family

Protein Properties

Length: 97aa MW: 11010.6 Da PI: 8.0518

Description

B3 family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Eucgr.G01639.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	B3	51.6	1.7e-16	2	80	17	98
E--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS B3 17 vlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 +p +f+++h k+e+ ++ s r W+vkl+ k +++ vl++GW+ F+++ gL+++D++vF+l++r++ + v++f+ Eucgr.G01639.1.p 2 GVPSEFFRKHLRKSEQ---MVTLKCSDRLWQVKLKSYKPRDTAVLSTGWSLFARETGLRARDVCVFELTDRDNIVFEVSIFS 80 689*****655444...44455688***98888889************************99888888998887 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM01019	3.7E-5	1	82	IPR003340	B3 DNA binding domain
CDD	cd10017	1.51E-16	1	80	No hit	No description
PROSITE profile	PS50863	14.043	1	82	IPR003340	B3 DNA binding domain
SuperFamily	SSF101936	1.24E-16	1	82	IPR015300	DNA-binding pseudobarrel domain
Pfam	PF02362	1.1E-13	2	81	IPR003340	B3 DNA binding domain
Gene3D	G3DSA:2.40.330.10	2.4E-20	2	83	IPR015300	DNA-binding pseudobarrel domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 97 aa Download sequence Send to blast
MGVPSEFFRK HLRKSEQMVT LKCSDRLWQV KLKSYKPRDT AVLSTGWSLF ARETGLRARD 60 VCVFELTDRD NIVFEVSIFS SDGQSIFSSA EVICID*

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Eucgr.G01639.1.p

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010066143.1	9e-63	PREDICTED: B3 domain-containing transcription factor VRN1 isoform X2
Refseq	XP_018732513.1	2e-62	PREDICTED: B3 domain-containing transcription factor VRN1 isoform X1
Refseq	XP_018732514.1	9e-63	PREDICTED: B3 domain-containing transcription factor VRN1 isoform X2
Refseq	XP_018732515.1	9e-63	PREDICTED: B3 domain-containing transcription factor VRN1 isoform X2
TrEMBL	A0A059BCP0	5e-64	A0A059BCP0_EUCGR; Uncharacterized protein
STRING	XP_010066143.1	3e-62	(Eucalyptus grandis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM14804	4	15

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G33280.1	4e-09	B3 family protein

Link Out ? help Back to Top
Phytozome	Eucgr.G01639.1.p