PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Eucgr.G02345.1.p

Common Name

EUGRSUZ_G02345

Organism

Eucalyptus grandis

Taxonomic ID

71139

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus

Family

Protein Properties

Length: 128aa MW: 14348.7 Da PI: 10.3391

Description

B3 family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Eucgr.G02345.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	B3	67.7	1.6e-21	3	64	33	94
-SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS B3 33 sktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 ++ l +ed g++W+++++y+++s++yvltkGW++Fvk++ Lk+gD+v F+++ +++l++ Eucgr.G02345.1.p 3 GVLLNFEDVGGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDTVCFQRSTGPDKQLYI 64 567899*********************************************87656666665 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50863	13.112	1	69	IPR003340	B3 DNA binding domain
SMART	SM01019	0.0076	1	70	IPR003340	B3 DNA binding domain
SuperFamily	SSF101936	3.79E-19	2	65	IPR015300	DNA-binding pseudobarrel domain
Gene3D	G3DSA:2.40.330.10	7.8E-24	2	76	IPR015300	DNA-binding pseudobarrel domain
Pfam	PF02362	1.0E-18	3	65	IPR003340	B3 DNA binding domain
CDD	cd10017	4.30E-15	8	55	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 128 aa Download sequence Send to blast
MKGVLLNFED VGGKVWRFRY SYWNSSQSYV LTKGWSRFVK EKSLKAGDTV CFQRSTGPDK 60 QLYIDFKPRG QPPAGPAAPP PPPVQMVRLF GVNIMEVPYC GGGKRMRDVD LLSFECRKKQ 120 QMVVGAL*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wid_A	9e-36	1	79	49	127	DNA-binding protein RAV1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional repressor of flowering time on long day plants. Acts directly on FT expression by binding 5'-CAACA-3' and 5'-CACCTG-3 sequences. Functionally redundant with TEM2. {ECO:0000269\|PubMed:18718758}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Eucgr.G02345.1.p

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Expressed with a circadian rhythm showing a peak at dawn. {ECO:0000269\|PubMed:18718758}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	HG670306	2e-39	HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018823697.1	2e-57	PREDICTED: AP2/ERF and B3 domain-containing transcription factor RAV1-like
Refseq	XP_018854263.1	6e-59	PREDICTED: AP2/ERF and B3 domain-containing transcription repressor RAV2-like, partial
Swissprot	Q9C6M5	8e-45	RAVL1_ARATH; AP2/ERF and B3 domain-containing transcription repressor TEM1
TrEMBL	A0A059BGF6	1e-88	A0A059BGF6_EUCGR; Uncharacterized protein
STRING	XP_009613275.1	3e-54	(Nicotiana tomentosiformis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM848	27	121

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G25560.1	3e-45	RAV family protein

Link Out ? help Back to Top
Phytozome	Eucgr.G02345.1.p

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Choi D, et al. iNID: an analytical framework for identifying network models for interplays among developmental signaling in Arabidopsis. Mol Plant, 2014. 7(5): p. 792-813 [PMID:24380880] Sgamma T,Jackson A,Muleo R,Thomas B,Massiah A TEMPRANILLO is a regulator of juvenility in plants. Sci Rep, 2014. 4: p. 3704 [PMID:24424565] Matías-Hernández L,Aguilar-Jaramillo AE,Marín-González E,Suárez-López P,Pelaz S RAV genes: regulation of floral induction and beyond. Ann. Bot., 2014. 114(7): p. 1459-70 [PMID:24812253] Marín-González E, et al. SHORT VEGETATIVE PHASE Up-Regulates TEMPRANILLO2 Floral Repressor at Low Ambient Temperatures. Plant Physiol., 2015. 169(2): p. 1214-24 [PMID:26243615] Matías-Hernández L, et al. TEMPRANILLO Reveals the Mesophyll as Crucial for Epidermal Trichome Formation. Plant Physiol., 2016. 170(3): p. 1624-39 [PMID:26802039]