![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Eucgr.G03377.1.p | ||||||||
| Common Name | EUGRSUZ_G03377 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
| Family | NF-YA | ||||||||
| Protein Properties | Length: 151aa MW: 16669.8 Da PI: 10.6462 | ||||||||
| Description | NF-YA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | CBFB_NFYA | 100.2 | 2e-31 | 9 | 65 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
+ep+YVNaKQy++Il+RR Rak+e ++k k+rkpylheSRh+hA+rRpRgsgGrF
Eucgr.G03377.1.p 9 EEPVYVNAKQYHGILRRRRIRAKAELDRKA-VKGRKPYLHESRHRHAMRRPRGSGGRF 65
69**************************99.**************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00521 | 4.0E-34 | 7 | 68 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE profile | PS51152 | 36.858 | 8 | 68 | IPR001289 | Nuclear transcription factor Y subunit A |
| Pfam | PF02045 | 4.0E-27 | 10 | 65 | IPR001289 | Nuclear transcription factor Y subunit A |
| PRINTS | PR00616 | 3.3E-24 | 11 | 33 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE pattern | PS00686 | 0 | 13 | 33 | IPR018362 | CCAAT-binding factor, conserved site |
| PRINTS | PR00616 | 3.3E-24 | 42 | 65 | IPR001289 | Nuclear transcription factor Y subunit A |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 151 aa Download sequence Send to blast |
MPLPLEMAEE PVYVNAKQYH GILRRRRIRA KAELDRKAVK GRKPYLHESR HRHAMRRPRG 60 SGGRFLNTKR LDSDDSSFAA EKAVNSSVDL PTQFVKTSTA QGFQTRSMRA DSTGSNGNAS 120 ANGLSYQGIS CLGAEKETLQ LYEGPNGAYK * |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4awl_A | 2e-21 | 9 | 73 | 2 | 66 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
| Search in ModeBase | ||||||
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 49 | 58 | RHRHAMRRPR |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Eucgr.G03377.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010067868.1 | 1e-107 | PREDICTED: nuclear transcription factor Y subunit A-9 | ||||
| Swissprot | Q945M9 | 2e-32 | NFYA9_ARATH; Nuclear transcription factor Y subunit A-9 | ||||
| TrEMBL | A0A059BJ90 | 1e-107 | A0A059BJ90_EUCGR; Uncharacterized protein | ||||
| STRING | XP_010067868.1 | 1e-106 | (Eucalyptus grandis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM16019 | 10 | 14 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G20910.1 | 7e-35 | nuclear factor Y, subunit A9 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Eucgr.G03377.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




