![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Eucgr.H01753.1.p | ||||||||
| Common Name | EUGRSUZ_H01753 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 74aa MW: 8456.45 Da PI: 10.4633 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 36.8 | 9.3e-12 | 2 | 46 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
+WT+eE+ l++ + ++ +g+W+ I+r + k+Rt+ q+ s+ qky
Eucgr.H01753.1.p 2 PWTEEEHGLFLLGLQKGAKGDWRGISRNFVKTRTPVQVASHAQKY 46
8*******************************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| TIGRFAMs | TIGR01557 | 8.8E-14 | 1 | 49 | IPR006447 | Myb domain, plants |
| PROSITE profile | PS51294 | 14.072 | 1 | 51 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 5.44E-15 | 2 | 52 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 1.5E-8 | 2 | 46 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 2.0E-9 | 2 | 46 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 9.80E-6 | 2 | 47 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 74 aa Download sequence Send to blast |
VPWTEEEHGL FLLGLQKGAK GDWRGISRNF VKTRTPVQVA SHAQKYFIQL SNQNGRRWRS 60 SLFDITTDSE TQH* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional repressor (PubMed:23888064, PubMed:24806884). Direct regulator of the transcription of peroxidase (Prxs) and reactive oxygen species (ROS)-related genes via the recognition of 5'-ATCACA-3' motif (PubMed:24806884). Binds to 5'-TATCCA-3' motif (TA box) and represses the activity of corresponding promoters (e.g. sugar response genes) (PubMed:25920996). Regulates hypocotyl elongation in response to darkness by enhancing auxin accumulation in a phytochrome-interacting factor (PIF) proteins-dependent manner. Promotes lateral roots formation (PubMed:23888064). Promotes cell expansion during leaves development via the modulation of cell wall-located Prxs (PubMed:24806884). Plays a critical role in developmentally regulated and dark-induced onset of leaf senescence by repressing the transcription of several genes involved in chloroplast function and responses to light and auxin. Promotes responses to auxin, abscisic acid (ABA), and ethylene (PubMed:25920996). {ECO:0000269|PubMed:23888064, ECO:0000269|PubMed:24806884, ECO:0000269|PubMed:25920996}. | |||||
| UniProt | Transcription repressor that binds to 5'-TATCCA-3' elements in gene promoters. Contributes to the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. Transcription repressor involved in a cold stress response pathway that confers cold tolerance. Suppresses the DREB1-dependent signaling pathway under prolonged cold stress. DREB1 responds quickly and transiently while MYBS3 responds slowly to cold stress. They may act sequentially and complementarily for adaptation to short- and long-term cold stress (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Eucgr.H01753.1.p |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Repressed by sucrose and gibberellic acid (GA) (PubMed:12172034). Induced by cold stress in roots and shoots. Induced by salt stress in shoots. Down-regulated by abscisic aci (ABA) in shoots (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}. | |||||
| UniProt | INDUCTION: Slightly induced by CdCl(2) (PubMed:16463103). Accumulates in the dark (PubMed:23888064, PubMed:25920996). Diurnal expression pattern with maximal levels in the morning (at protein level). Specifically induced during leaf expansion (PubMed:24806884). Expressed in old and dark-treated leaves (PubMed:25920996). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:23888064, ECO:0000269|PubMed:24806884, ECO:0000269|PubMed:25920996}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018715804.1 | 8e-44 | PREDICTED: TMV resistance protein N | ||||
| Swissprot | Q7XC57 | 3e-29 | MYBS3_ORYSJ; Transcription factor MYBS3 | ||||
| Swissprot | Q9LVS0 | 4e-29 | KUA1_ARATH; Transcription factor KUA1 | ||||
| TrEMBL | A0A059AZQ7 | 3e-47 | A0A059AZQ7_EUCGR; Uncharacterized protein (Fragment) | ||||
| STRING | XP_010026324.1 | 3e-43 | (Eucalyptus grandis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM20477 | 5 | 5 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G47390.1 | 2e-31 | MYB_related family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Eucgr.H01753.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




