![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Eucgr.H04502.1.p | ||||||||
| Common Name | EUGRSUZ_H04502, LOC104415566 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 170aa MW: 19101 Da PI: 5.1462 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 158.3 | 1.2e-49 | 3 | 98 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96
eq+++lPianv+rimk +lP akisk+ak+t+qec+sefisfvt+easdkc++e+rkt+ngdd++wal++lGf+dy+e++ yl+kyre e+e
Eucgr.H04502.1.p 3 DEQEKLLPIANVGRIMKLILPPSAKISKEAKQTIQECASEFISFVTGEASDKCHKENRKTVNGDDICWALSSLGFDDYAEAIVRYLHKYREHESE 97
69******************************************************************************************998 PP
NF-YB 97 k 97
+
Eucgr.H04502.1.p 98 R 98
6 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 3.3E-50 | 2 | 132 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 2.42E-37 | 5 | 109 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 1.1E-25 | 9 | 72 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 4.1E-18 | 36 | 54 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 39 | 55 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 4.1E-18 | 55 | 73 | No hit | No description |
| PRINTS | PR00615 | 4.1E-18 | 74 | 92 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 170 aa Download sequence Send to blast |
MVDEQEKLLP IANVGRIMKL ILPPSAKISK EAKQTIQECA SEFISFVTGE ASDKCHKENR 60 KTVNGDDICW ALSSLGFDDY AEAIVRYLHK YREHESERAN CKQQTSKARN VTGRHDHEDK 120 VEGEDDDDDD DEGSCHTDSQ RGKGITSTCH RHPAPLEFRI IDRNETSPS* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 1e-40 | 2 | 93 | 1 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 1e-40 | 2 | 93 | 1 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Eucgr.H04502.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010025198.1 | 1e-124 | PREDICTED: nuclear transcription factor Y subunit B-5 | ||||
| Swissprot | O82248 | 5e-52 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
| TrEMBL | A0A059B7C7 | 1e-123 | A0A059B7C7_EUCGR; Uncharacterized protein | ||||
| STRING | XP_010025198.1 | 1e-124 | (Eucalyptus grandis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM255 | 28 | 229 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G47810.1 | 2e-54 | nuclear factor Y, subunit B5 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Eucgr.H04502.1.p |
| Entrez Gene | 104415566 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




