![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Eucgr.I00098.1.p | ||||||||
| Common Name | EUGRSUZ_I00098 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 105aa MW: 12351.2 Da PI: 8.3293 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 56 | 1.3e-17 | 44 | 92 | 1 | 50 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkk 50
lp+GfrFhPtdeelv++yL +k+++ ++++ +i+e+d+yk++PwdLp +
Eucgr.I00098.1.p 44 LPAGFRFHPTDEELVSDYLIRKCASLPISA-PIIAEIDLYKFDPWDLPGT 92
799*************************99.88**************943 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 7.06E-20 | 38 | 93 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 19.975 | 44 | 104 | IPR003441 | NAC domain |
| Pfam | PF02365 | 3.0E-7 | 45 | 87 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 105 aa Download sequence Send to blast |
SRVEQVQGLV EKGTDQRVSR RRRTESREER EREREKMKKA QMELPAGFRF HPTDEELVSD 60 YLIRKCASLP ISAPIIAEID LYKFDPWDLP GTFRPFLCFF RLCC* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3ulx_A | 3e-20 | 34 | 90 | 5 | 61 | Stress-induced transcription factor NAC1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | May be involved in regulation of seed germination under flooding. {ECO:0000269|PubMed:19176720}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Eucgr.I00098.1.p |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By low-oxygen stress. {ECO:0000269|PubMed:19176720}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010027536.1 | 3e-31 | PREDICTED: NAC domain-containing protein 2 isoform X1 | ||||
| Refseq | XP_010027538.1 | 2e-31 | PREDICTED: NAC domain-containing protein 2 isoform X2 | ||||
| Swissprot | Q8H115 | 5e-22 | NA102_ARATH; NAC domain-containing protein 102 | ||||
| TrEMBL | A0A059AK49 | 1e-69 | A0A059AK49_EUCGR; Uncharacterized protein (Fragment) | ||||
| STRING | XP_010027536.1 | 1e-30 | (Eucalyptus grandis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM7967 | 13 | 40 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G63790.1 | 9e-25 | NAC domain containing protein 102 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Eucgr.I00098.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




