PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Eucgr.I01942.1.p

Common Name

EUGRSUZ_I01942

Organism

Eucalyptus grandis

Taxonomic ID

71139

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus

Family

ZF-HD

Protein Properties

Length: 81aa MW: 8741.98 Da PI: 9.1299

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Eucgr.I01942.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	93.4	2e-29	22	77	3	59
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 ++rY eC kN+A s+GghavDGC+Efm+ geegtaaal CaACgCHR+FH+r v + Eucgr.I01942.1.p 22 TIRYGECEKNQAESIGGHAVDGCREFMAR-GEEGTAAALICAACGCHRSFHKRIVMT 77 79************************8.999*****************98765 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD125774	2.0E-19	22	78	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Pfam	PF04770	1.1E-27	23	73	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	2.8E-23	24	73	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	24.923	25	74	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Sequence ? help Back to Top
Protein Sequence Length: 81 aa Download sequence Send to blast
MKRVRVVVVK GSSASSRRRG ETIRYGECEK NQAESIGGHA VDGCREFMAR GEEGTAAALI 60 CAACGCHRSF HKRIVMTENQ *

Functional Description ? help Back to Top
Source	Description
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269\|PubMed:21455630}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Eucgr.I01942.1.p

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_027187539.1	2e-27	mini zinc finger protein 2-like
Refseq	XP_027187540.1	2e-27	mini zinc finger protein 2-like
Swissprot	Q9LJW5	7e-26	MIF2_ARATH; Mini zinc finger protein 2
TrEMBL	A0A059AQD8	5e-50	A0A059AQD8_EUCGR; Uncharacterized protein
STRING	XP_004489393.1	1e-26	(Cicer arietinum)
STRING	XP_004489394.1	1e-26	(Cicer arietinum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM944	28	114

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G28917.1	8e-28	mini zinc finger 2

Link Out ? help Back to Top
Phytozome	Eucgr.I01942.1.p

Publications ? help Back to Top
Bollier N, et al. At-MINI ZINC FINGER2 and Sl-INHIBITOR OF MERISTEM ACTIVITY, a Conserved Missing Link in the Regulation of Floral Meristem Termination in Arabidopsis and Tomato. Plant Cell, 2018. 30(1): p. 83-100 [PMID:29298836]