PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Eucgr.I02596.1.p

Common Name

EUGRSUZ_I02596

Organism

Eucalyptus grandis

Taxonomic ID

71139

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus

Family

M-type_MADS

Protein Properties

Length: 103aa MW: 11653.5 Da PI: 10.1957

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Eucgr.I02596.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	79.7	2.1e-25	11	59	3	51
--SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 i+ + rqvtf kRr+g++KKA ELS+LCdae+ viifs tgklyey+s Eucgr.I02596.1.p 11 INCSKSRQVTFFKRRTGLMKKARELSILCDAEIGVIIFSCTGKLYEYAS 59 666789*****************************************86 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	27.389	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	4.6E-31	1	60	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	1.02E-29	3	82	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.2E-24	3	23	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.94E-36	3	78	No hit	No description
Pfam	PF00319	2.0E-24	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.2E-24	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.2E-24	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 103 aa Download sequence Send to blast
MVKGKIAIRK INCSKSRQVT FFKRRTGLMK KARELSILCD AEIGVIIFSC TGKLYEYAST 60 SMSSVIERYN KMKQDNQQQS ITTEEIQVNA KDQVKHLQTS DS*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	1e-20	1	80	1	80	MEF2C
5f28_B	1e-20	1	80	1	80	MEF2C
5f28_C	1e-20	1	80	1	80	MEF2C
5f28_D	1e-20	1	80	1	80	MEF2C
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the regulation of flowering time in long-day photoperiod. Participates in the repression of FT expression and floral transition, by interacting closely with the FLC-SVP pathways (PubMed:24876250). Functions in the satellite meristemoid lineage of stomatal development (PubMed:17704216). {ECO:0000269\|PubMed:17704216, ECO:0000269\|PubMed:24876250}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Eucgr.I02596.1.p

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed by the micro RNA miR824. {ECO:0000269\|PubMed:18579782}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010029968.1	1e-56	PREDICTED: MADS-box transcription factor 23
Refseq	XP_010029969.1	1e-56	PREDICTED: MADS-box transcription factor 23
Swissprot	A2RVQ5	1e-32	AGL16_ARATH; Agamous-like MADS-box protein AGL16
TrEMBL	A0A059AT47	3e-68	A0A059AT47_EUCGR; Uncharacterized protein
STRING	XP_010029968.1	4e-56	(Eucalyptus grandis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM78	28	413

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G57230.1	5e-35	AGAMOUS-like 16

Link Out ? help Back to Top
Phytozome	Eucgr.I02596.1.p

Publications ? help Back to Top
Yang K,Jiang M,Le J A new loss-of-function allele 28y reveals a role of ARGONAUTE1 in limiting asymmetric division of stomatal lineage ground cell. J Integr Plant Biol, 2014. 56(6): p. 539-49 [PMID:24386951]