![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Eucgr.J00521.1.p | ||||||||
| Common Name | EUGRSUZ_J00521 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 170aa MW: 18876.4 Da PI: 10.2005 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 64.2 | 4e-20 | 3 | 65 | 66 | 128 |
NAM 66 kkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
+++a+g r++r+t+ gyWkatg+ +v+s++++++g+kk++vfy g+ap+g+kt+W ++eyr+
Eucgr.J00521.1.p 3 ERQARGGRPSRSTAVGYWKATGSPCQVYSSENKVIGMKKSMVFYVGKAPTGRKTKWKLNEYRA 65
567899*******************************************************96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51005 | 24.656 | 1 | 98 | IPR003441 | NAC domain |
| SuperFamily | SSF101941 | 9.29E-20 | 4 | 97 | IPR003441 | NAC domain |
| Pfam | PF02365 | 4.9E-8 | 9 | 64 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 170 aa Download sequence Send to blast |
MQERQARGGR PSRSTAVGYW KATGSPCQVY SSENKVIGMK KSMVFYVGKA PTGRKTKWKL 60 NEYRAIEIIS PPAPNSSSSS VPMFRLRHEF TLCRVYVVSG SSRAFDRRPL KLVARETIQD 120 GDGGGSSSGE SASPSGSVIE NNVGISHFMK TISMEKEEPI WDWEQFNWF* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 1e-16 | 8 | 103 | 86 | 170 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 1e-16 | 8 | 103 | 86 | 170 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 1e-16 | 8 | 103 | 86 | 170 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 1e-16 | 8 | 103 | 86 | 170 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 1e-16 | 8 | 103 | 89 | 173 | NAC domain-containing protein 19 |
| 3swm_B | 1e-16 | 8 | 103 | 89 | 173 | NAC domain-containing protein 19 |
| 3swm_C | 1e-16 | 8 | 103 | 89 | 173 | NAC domain-containing protein 19 |
| 3swm_D | 1e-16 | 8 | 103 | 89 | 173 | NAC domain-containing protein 19 |
| 3swp_A | 1e-16 | 8 | 103 | 89 | 173 | NAC domain-containing protein 19 |
| 3swp_B | 1e-16 | 8 | 103 | 89 | 173 | NAC domain-containing protein 19 |
| 3swp_C | 1e-16 | 8 | 103 | 89 | 173 | NAC domain-containing protein 19 |
| 3swp_D | 1e-16 | 8 | 103 | 89 | 173 | NAC domain-containing protein 19 |
| 4dul_A | 1e-16 | 8 | 103 | 86 | 170 | NAC domain-containing protein 19 |
| 4dul_B | 1e-16 | 8 | 103 | 86 | 170 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Eucgr.J00521.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010034224.1 | 1e-85 | PREDICTED: NAC domain-containing protein 90 | ||||
| Swissprot | Q9FMR3 | 5e-50 | NAC90_ARATH; NAC domain-containing protein 90 | ||||
| TrEMBL | A0A059AAM4 | 1e-121 | A0A059AAM4_EUCGR; Uncharacterized protein | ||||
| STRING | XP_010034224.1 | 4e-85 | (Eucalyptus grandis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM1445 | 28 | 93 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G44350.2 | 2e-49 | NAC domain containing protein 61 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Eucgr.J00521.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




