![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Eucgr.J01756.1.p | ||||||||
| Common Name | EUGRSUZ_J01756 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 113aa MW: 12747.8 Da PI: 8.6601 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 72.9 | 4.3e-23 | 13 | 70 | 2 | 59 |
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
+Dgy+W+KYGqK +++ rsYY+C a+C++kk+ e s+++p + ++Yeg Hnh+
Eucgr.J01756.1.p 13 QDGYEWKKYGQKFIRNIGKFRSYYKCQRAECNAKKRAEWSETEPGDLRVVYEGAHNHS 70
7********************************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.20.25.80 | 1.3E-23 | 5 | 70 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 20.208 | 7 | 72 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 1.44E-21 | 8 | 70 | IPR003657 | WRKY domain |
| SMART | SM00774 | 1.3E-19 | 12 | 71 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 4.2E-20 | 13 | 69 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 113 aa Download sequence Send to blast |
MDREASSRLQ LPQDGYEWKK YGQKFIRNIG KFRSYYKCQR AECNAKKRAE WSETEPGDLR 60 VVYEGAHNHS SSLQDQSGSS QSGASSTSAN QYNLLNQVFG DNPPSDYRRS GD* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 3e-14 | 4 | 69 | 9 | 74 | Probable WRKY transcription factor 4 |
| 2lex_A | 3e-14 | 4 | 69 | 9 | 74 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Eucgr.J01756.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012075800.1 | 5e-42 | probable WRKY transcription factor 45 | ||||
| TrEMBL | A0A059AF13 | 5e-78 | A0A059AF13_EUCGR; Uncharacterized protein | ||||
| STRING | XP_006488951.1 | 2e-36 | (Citrus sinensis) | ||||
| STRING | XP_006445572.1 | 2e-36 | (Citrus clementina) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM23988 | 4 | 4 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G47260.1 | 1e-15 | WRKY DNA-binding protein 23 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Eucgr.J01756.1.p |




