PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.K00197.1.p
Common NameEUGRSUZ_K00197
Organism
Eucalyptus grandis
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family M-type_MADS
Protein Properties Length: 70aa    MW: 7903.23 Da    PI: 10.2889
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.K00197.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF90.31e-281059251
                      ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      rien + +qvtfskR++g+lKKA+ELSvLCdaev +iifs++g+lye+ss
  Eucgr.K00197.1.p 10 RIENATSQQVTFSKRQAGLLKKAYELSVLCDAEVTMIIFSQKGRLYEFSS 59
                      8***********************************************96 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.7E-36160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.614161IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.42E-27161IPR002100Transcription factor, MADS-box
CDDcd002657.96E-35261No hitNo description
PRINTSPR004041.8E-29323IPR002100Transcription factor, MADS-box
PfamPF003193.0E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-293859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 70 aa     Download sequence    Send to blast
MARGKVQMRR IENATSQQVT FSKRQAGLLK KAYELSVLCD AEVTMIIFSQ KGRLYEFSST  60
SEYVRVPIL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P4e-19161161Myocyte-specific enhancer factor 2B
1tqe_Q4e-19161161Myocyte-specific enhancer factor 2B
1tqe_R4e-19161161Myocyte-specific enhancer factor 2B
1tqe_S4e-19161161Myocyte-specific enhancer factor 2B
6c9l_A4e-19161161Myocyte-specific enhancer factor 2B
6c9l_B4e-19161161Myocyte-specific enhancer factor 2B
6c9l_C4e-19161161Myocyte-specific enhancer factor 2B
6c9l_D4e-19161161Myocyte-specific enhancer factor 2B
6c9l_E4e-19161161Myocyte-specific enhancer factor 2B
6c9l_F4e-19161161Myocyte-specific enhancer factor 2B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtMADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.K00197.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010035068.13e-33PREDICTED: MADS-box protein AGL42
SwissprotQ9FIS17e-29AGL42_ARATH; MADS-box protein AGL42
TrEMBLA0A058ZX098e-43A0A058ZX09_EUCGR; Uncharacterized protein
STRINGXP_010035068.11e-32(Eucalyptus grandis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62165.43e-31AGAMOUS-like 42