![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | FANhyb_icon00003816_a.1.g00001.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
|
||||||||
| Family | TALE | ||||||||
| Protein Properties | Length: 134aa MW: 15752.7 Da PI: 9.5335 | ||||||||
| Description | TALE family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Homeobox | 28.8 | 2.1e-09 | 78 | 113 | 20 | 55 |
HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
Homeobox 20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55
+k +yp++ ++ LA+ +gL+++q+ +WF N+R ++
FANhyb_icon00003816_a.1.g00001.1 78 YKWPYPTEVDKMTLAQVTGLDQKQINNWFINQRKRH 113
4679*****************************985 PP
| |||||||
| 2 | ELK | 41.2 | 3.5e-14 | 33 | 54 | 1 | 22 |
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22
ELK+ LlrKYsgy+++LkqEFs
FANhyb_icon00003816_a.1.g00001.1 33 ELKDKLLRKYSGYISTLKQEFS 54
9********************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF03789 | 1.3E-11 | 33 | 54 | IPR005539 | ELK domain |
| PROSITE profile | PS51213 | 11.086 | 33 | 53 | IPR005539 | ELK domain |
| SMART | SM01188 | 7.1E-8 | 33 | 54 | IPR005539 | ELK domain |
| PROSITE profile | PS50071 | 12.163 | 53 | 116 | IPR001356 | Homeobox domain |
| SuperFamily | SSF46689 | 8.13E-20 | 55 | 126 | IPR009057 | Homeodomain-like |
| SMART | SM00389 | 1.0E-11 | 55 | 120 | IPR001356 | Homeobox domain |
| Gene3D | G3DSA:1.10.10.60 | 5.8E-28 | 58 | 118 | IPR009057 | Homeodomain-like |
| CDD | cd00086 | 5.91E-11 | 65 | 117 | No hit | No description |
| Pfam | PF05920 | 3.5E-17 | 73 | 112 | IPR008422 | Homeobox KN domain |
| PROSITE pattern | PS00027 | 0 | 91 | 114 | IPR017970 | Homeobox, conserved site |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0010073 | Biological Process | meristem maintenance | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 134 aa Download sequence Send to blast |
DAPAGNSSDY EDMSGGEIDV QDSDHQQRNV NHELKDKLLR KYSGYISTLK QEFSQKKKKG 60 KLPKDAKQIL ADWWNLHYKW PYPTEVDKMT LAQVTGLDQK QINNWFINQR KRHWKPSENM 120 QFAVMESLYG PRPV |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Plays a role in meristem function. Contributes to the shoot apical meristem (SAM) maintenance and organ separation by controlling boundary establishment in embryo in a CUC1, CUC2 and STM-dependent manner. Involved in maintaining cells in an undifferentiated, meristematic state. Probably binds to the DNA sequence 5'-TGAC-3'. {ECO:0000269|PubMed:16798887}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Seems to be repressed by AS2 and AS1 but induced by STM, CUC1 and CUC2. {ECO:0000269|PubMed:11311158, ECO:0000269|PubMed:16798887}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001266984.1 | 4e-91 | homeobox protein knotted-1-like 6-like | ||||
| Swissprot | Q84JS6 | 2e-49 | KNAT6_ARATH; Homeobox protein knotted-1-like 6 | ||||
| TrEMBL | F5A6B4 | 1e-89 | F5A6B4_FRAVE; Knotted-like homeobox KNOX4 | ||||
| STRING | XP_004298960.1 | 2e-94 | (Fragaria vesca) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF620 | 34 | 125 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G23380.2 | 2e-47 | KNOTTED1-like homeobox gene 6 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




