![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | FANhyb_icon00007937_a.1.g00001.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 60aa MW: 6976.08 Da PI: 4.057 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 55.1 | 2.6e-17 | 14 | 60 | 1 | 48 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
lppGfrF Ptdeel+v+yL++kv+g +++l ++i+e+d+yk++Pw Lp
FANhyb_icon00007937_a.1.g00001.1 14 LPPGFRFYPTDEELLVQYLCRKVAGYQFNL-QIIAEIDLYKFDPWVLP 60
79****************************.89************997 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 3.4E-18 | 9 | 60 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 20.821 | 14 | 60 | IPR003441 | NAC domain |
| Pfam | PF02365 | 3.1E-7 | 15 | 57 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 60 aa Download sequence Send to blast |
MGVPETDPLS QLSLPPGFRF YPTDEELLVQ YLCRKVAGYQ FNLQIIAEID LYKFDPWVLP |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 5e-34 | 1 | 60 | 4 | 63 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 5e-34 | 1 | 60 | 4 | 63 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 5e-34 | 1 | 60 | 4 | 63 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 5e-34 | 1 | 60 | 4 | 63 | NO APICAL MERISTEM PROTEIN |
| 4dul_A | 5e-34 | 1 | 60 | 4 | 63 | NAC domain-containing protein 19 |
| 4dul_B | 5e-34 | 1 | 60 | 4 | 63 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factors that bind specifically to the 5'-CATGTG-3' motif. {ECO:0000269|PubMed:15319476}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by drought, high salinity and abscisic acid (ABA). Slightly up-regulated by jasmonic acid. Not induced by cold treatment. {ECO:0000269|PubMed:12646039, ECO:0000269|PubMed:15319476}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_008345087.2 | 2e-37 | LOW QUALITY PROTEIN: NAC domain-containing protein 72-like | ||||
| Swissprot | Q9C932 | 7e-35 | NAC19_ARATH; NAC domain-containing protein 19 | ||||
| TrEMBL | S5RDS7 | 8e-37 | S5RDS7_MALHU; NAC domain protein | ||||
| STRING | XP_008345087.1 | 4e-37 | (Malus domestica) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF4429 | 33 | 60 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G52890.1 | 3e-37 | NAC domain containing protein 19 | ||||




