PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

FANhyb_icon00008008_a.1.g00001.1

Organism

Fragaria x ananassa

Taxonomic ID

3747

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria

Family

LBD

Protein Properties

Length: 51aa MW: 5854.92 Da PI: 9.3719

Description

LBD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
FANhyb_icon00008008_a.1.g00001.1	genome	kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	DUF260	70.3	3.9e-22	5	51	1	47
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllk 47 +CaaCk+lr++C++dC++apyfp+++p++f+nvh+++Ga+nv +lk FANhyb_icon00008008_a.1.g00001.1 5 RCAACKYLRKACPEDCIFAPYFPSNNPQRFENVHRIYGAKNVATMLK 51 6******************************************9986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50891	17.248	4	51	IPR004883	Lateral organ boundaries, LOB
Pfam	PF03195	1.2E-20	5	51	IPR004883	Lateral organ boundaries, LOB

Sequence ? help Back to Top
Protein Sequence Length: 51 aa Download sequence Send to blast
MVMGRCAACK YLRKACPEDC IFAPYFPSNN PQRFENVHRI YGAKNVATML K

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5ly0_A	3e-15	6	50	12	56	LOB family transfactor Ramosa2.1
5ly0_B	3e-15	6	50	12	56	LOB family transfactor Ramosa2.1
Search in ModeBase

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004309226.1	2e-32	PREDICTED: LOB domain-containing protein 24-like
Swissprot	P59467	2e-20	LBD23_ARATH; LOB domain-containing protein 23
Swissprot	P59468	2e-20	LBD24_ARATH; LOB domain-containing protein 24
TrEMBL	A0A2P6SMZ9	2e-24	A0A2P6SMZ9_ROSCH; Putative transcription factor AS2-LOB family
STRING	XP_004309226.1	9e-32	(Fragaria vesca)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF3697	30	66

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G26620.1	8e-23	LOB domain-containing protein 23