![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | FANhyb_icon00011864_a.1.g00001.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 86aa MW: 9679.85 Da PI: 4.1756 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 36 | 1.9e-11 | 45 | 86 | 2 | 43 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHH CS
HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpk 43
Fl+k+y++++d+++++++sws+ g sfvv+d+++f ++Lp+
FANhyb_icon00011864_a.1.g00001.1 45 FLNKTYDMVDDPSTNRIVSWSRAGGSFVVWDPHSFVMNLLPR 86
9**********************************9999985 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.10 | 2.9E-13 | 38 | 86 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SuperFamily | SSF46785 | 8.43E-11 | 41 | 86 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SMART | SM00415 | 0.0022 | 41 | 86 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Pfam | PF00447 | 4.7E-9 | 45 | 85 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 9.6E-6 | 45 | 68 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 9.6E-6 | 83 | 86 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 86 aa Download sequence Send to blast |
MNYLYPVKEE YLGDSSTSQY WSGDPLVVAP PQPMEGLNDT GPPPFLNKTY DMVDDPSTNR 60 IVSWSRAGGS FVVWDPHSFV MNLLPR |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000269|PubMed:16202242}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By heat stress. {ECO:0000269|PubMed:16202242}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004290633.1 | 7e-55 | PREDICTED: heat stress transcription factor A-7a | ||||
| Swissprot | Q338B0 | 2e-24 | HFA2C_ORYSJ; Heat stress transcription factor A-2c | ||||
| TrEMBL | A0A1W6LWM8 | 8e-56 | A0A1W6LWM8_FRAAN; Heat shock transcription factor protein 5 | ||||
| STRING | XP_004290633.1 | 3e-54 | (Fragaria vesca) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1592 | 33 | 95 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G22830.1 | 4e-25 | heat shock transcription factor A6B | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




