![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | FANhyb_icon00012528_a.1.g00001.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 73aa MW: 8395.58 Da PI: 4.8679 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 79.9 | 4.1e-25 | 15 | 73 | 2 | 60 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
Fl k+y ++ed++++ +isw+e+g++fvv+++ efa+++Lp+ Fkhsnf+SFvRQLn+Y
FANhyb_icon00012528_a.1.g00001.1 15 FLLKTYMLVEDPATDAVISWNEDGSAFVVWQPAEFARDLLPTLFKHSNFSSFVRQLNTY 73
9*********************************************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.10 | 3.5E-27 | 7 | 73 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SuperFamily | SSF46785 | 1.29E-23 | 10 | 73 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SMART | SM00415 | 3.4E-17 | 11 | 73 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 4.8E-16 | 15 | 38 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Pfam | PF00447 | 3.3E-21 | 15 | 73 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 4.8E-16 | 53 | 65 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 4.8E-16 | 66 | 73 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 73 aa Download sequence Send to blast |
VLLEYVTRKS SPPPFLLKTY MLVEDPATDA VISWNEDGSA FVVWQPAEFA RDLLPTLFKH 60 SNFSSFVRQL NTY |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 2ldu_A | 1e-17 | 10 | 73 | 15 | 78 | Heat shock factor protein 1 |
| 5d5u_B | 1e-17 | 10 | 73 | 24 | 87 | Heat shock factor protein 1 |
| 5d5v_B | 1e-17 | 10 | 73 | 24 | 87 | Heat shock factor protein 1 |
| 5d5v_D | 1e-17 | 10 | 73 | 24 | 87 | Heat shock factor protein 1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional regulator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004304340.1 | 3e-47 | PREDICTED: heat stress transcription factor B-3 | ||||
| Swissprot | O22230 | 6e-35 | HSFB3_ARATH; Heat stress transcription factor B-3 | ||||
| TrEMBL | A0A1B0VB98 | 6e-46 | A0A1B0VB98_FRAVE; Heat shock factor B3a | ||||
| STRING | XP_004304340.1 | 1e-46 | (Fragaria vesca) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1592 | 33 | 95 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G41690.1 | 2e-37 | heat shock transcription factor B3 | ||||




