![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | FANhyb_icon00024544_a.1.g00001.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 63aa MW: 7153.02 Da PI: 9.2709 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 58 | 1.8e-18 | 1 | 37 | 23 | 59 |
EEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 23 sYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
sYYrCt+++C vkk+vers edp++v++tYeg+Hnh+
FANhyb_icon00024544_a.1.g00001.1 1 SYYRCTTQKCGVKKRVERSFEDPSTVITTYEGQHNHP 37
8***********************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF118290 | 3.53E-15 | 1 | 39 | IPR003657 | WRKY domain |
| Gene3D | G3DSA:2.20.25.80 | 1.0E-16 | 1 | 39 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 18.82 | 1 | 39 | IPR003657 | WRKY domain |
| SMART | SM00774 | 3.1E-9 | 1 | 38 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 3.3E-13 | 1 | 37 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 63 aa Download sequence Send to blast |
SYYRCTTQKC GVKKRVERSF EDPSTVITTY EGQHNHPIPA TLRGSININA AHHHHAFFSP 60 PSM |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 8e-14 | 1 | 40 | 39 | 78 | Probable WRKY transcription factor 4 |
| 2lex_A | 8e-14 | 1 | 40 | 39 | 78 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004293668.1 | 1e-38 | PREDICTED: probable WRKY transcription factor 71 | ||||
| Swissprot | Q93WV4 | 3e-23 | WRK71_ARATH; WRKY transcription factor 71 | ||||
| TrEMBL | A0A2P6Q5A4 | 8e-36 | A0A2P6Q5A4_ROSCH; Putative transcription factor WRKY family | ||||
| STRING | XP_004293668.1 | 5e-38 | (Fragaria vesca) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G29860.1 | 3e-25 | WRKY DNA-binding protein 71 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




