![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | FANhyb_icon00025891_a.1.g00001.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
|
||||||||
| Family | GRAS | ||||||||
| Protein Properties | Length: 80aa MW: 9459.88 Da PI: 9.9802 | ||||||||
| Description | GRAS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GRAS | 42.8 | 8.3e-14 | 1 | 75 | 299 | 373 |
GRAS 299 acegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
aceg +r+ r et+++W+ r ++aGF+++pl++++++++k +++ + + v+e+ ++++ gWk+r + +W
FANhyb_icon00025891_a.1.g00001.1 1 ACEGINRIVRPETYKQWQIRNTRAGFRQLPLDYEVVNKIKDKVKMEYHPNFVVNEDGHWMLHGWKGRMRLGSACW 75
7**********************************************999*****************88877777 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50985 | 11.626 | 1 | 56 | IPR005202 | Transcription factor GRAS |
| Pfam | PF03514 | 2.9E-11 | 1 | 75 | IPR005202 | Transcription factor GRAS |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 80 aa Download sequence Send to blast |
ACEGINRIVR PETYKQWQIR NTRAGFRQLP LDYEVVNKIK DKVKMEYHPN FVVNEDGHWM 60 LHGWKGRMRL GSACWAPSTT |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in plant development. {ECO:0000250}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004294644.1 | 8e-48 | PREDICTED: scarecrow-like protein 14 | ||||
| Refseq | XP_011461309.1 | 3e-48 | PREDICTED: scarecrow-like protein 14 | ||||
| Swissprot | Q3EDH0 | 8e-28 | SCL31_ARATH; Scarecrow-like protein 31 | ||||
| TrEMBL | A0A2P6QIX5 | 6e-42 | A0A2P6QIX5_ROSCH; Putative transcription factor GRAS family | ||||
| STRING | XP_004294644.1 | 3e-47 | (Fragaria vesca) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF14801 | 8 | 13 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G07520.1 | 3e-30 | GRAS family protein | ||||




